KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c07060Help
Entry
SS05631_c07060    CDS       T05069                                 

Definition
(GenBank) Manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Brite
Enzymes [BR:sino01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SS05631_c07060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASY55659
UniProt: A0A249NRD6
LinkDB All DBs
Position
689109..689711
Genome map
AA seq 200 aa AA seqDB search
MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSNLSVEEIVKKS
YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFIAAGT
AQFGSGWAWLSVKNGKLEISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA
FVDNLINWDYVLEMYEAAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgaaccttccctatgactacgatgcgctcgcgccctacatgtcg
cgcgagacgctcgaataccaccacgacaagcatcacctcgcctatgtgacgaacggcaac
aagctcgccgaggaagccggtctgtcgaacctttcggtggaggaaatcgtcaagaagtcc
tacggcaccaaccagccgctgttcaacaatgccggccagcactacaaccacgtccacttc
tggaagtggatgaagaagggcggcggcggcaccagcctgccgggcaagctcgacgcggcc
atcaagtccgatctcggcggctacgacaagttccgggccgacttcatcgccgccggcacc
gcccaattcggttccggttgggcctggctctcggtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctcgtgcacggcgcctcgccaatcctcggcgtcgac
gtctgggagcattcctattacatcgattaccgcaatgcccgtccgaaatacctcgaggct
ttcgtcgacaatctcatcaactgggattacgtcctcgaaatgtacgaggcagcggcgaag
taa

DBGET integrated database retrieval system