KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c11110Help
Entry
SS05631_c11110    CDS       T05069                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sino  Sinorhizobium sp. CCBAU 05631
Brite
KEGG Orthology (KO) [BR:sino00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sino03012]
    SS05631_c11110
   03029 Mitochondrial biogenesis [BR:sino03029]
    SS05631_c11110
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sino04147]
    SS05631_c11110
Translation factors [BR:sino03012]
 Eukaryotic Type
  Elongation factors
   SS05631_c11110
 Prokaryotic Type
   SS05631_c11110
Mitochondrial biogenesis [BR:sino03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SS05631_c11110
Exosome [BR:sino04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SS05631_c11110
  Exosomal proteins of breast cancer cells
   SS05631_c11110
  Exosomal proteins of colorectal cancer cells
   SS05631_c11110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ASY56058
UniProt: A0A249NRD5
LinkDB All DBs
Position
1078592..1079767
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQVLCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaattcgagcgcaacaagccgcacgtcaacatcggcacgattggccac
gttgaccatggcaagacgtcgctgactgcagcgatcaccaagtacttcggcgaattcaag
gcgtatgaccagatcgacgctgcgccggaagagaaggcgcgtggcatcaccatttcgacg
gcgcacgtcgaatacgagacgccggcccgccactatgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
gtgtccgccgccgacggcccgatgccgcagacccgcgagcacatcctgctcgcccgccag
gtcggcgttccggcgatcgtcgtgttcctgaacaaggtcgaccaggtcgacgacgccgag
cttctcgagctcgtcgagctggaagtgcgcgaactcttgtcgtcctacgaattcccgggc
gacgacattccgatcatcaagggttcggcgcttgccgctctcgaagactccgacaagaag
atcggcgaagacgcgatccgcgagctgatggctgctgtcgacgcctacatcccgacgccg
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgcggcacggtcgtgaccggccgcgtcgagcgcggcatcgtcaaggtcggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgctgcgcggtgtcgac
cgcaacggcgtcgagcgcggtcaggttctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggccgaagcctacatcctgacgaaggaagaaggcggccgtcacacgccgttc
ttcaccaactaccgcccgcagttctacttccgcacgacggacgtgacgggcatcgtgacg
ctgccggaaggcacggaaatggtgatgccgggcgacaacgtgacggtcgacgtcgagctg
atcgtgccgatcgccatggaagagaagctgcgcttcgctatccgtgaaggcggccgcacc
gtcggcgccggcatcgtcgcctccatcgtcgagtaa

DBGET integrated database retrieval system