KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c11950Help
Entry
SS05631_c11950    CDS       T05069                                 

Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00340  Histidine metabolism
sino01100  Metabolic pathways
sino01110  Biosynthesis of secondary metabolites
sino01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sino00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SS05631_c11950
Enzymes [BR:sino01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     SS05631_c11950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: ASY56140
UniProt: A0A249NR08
LinkDB All DBs
Position
complement(1149912..1150364)
Genome map
AA seq 150 aa AA seqDB search
MTLTFAAPSNDKAELEIGSAFTPRFDEKGLVTAVVTDARDGELLMVAHMNAEALALTIET
GIAHYFSRSRNSLWKKGESSGNVQAVQEIRTDCDQDAVWLKVTVAGHDATCHTGRRSCFY
RTVGVEGGEPKVTISDERRYFDPKLVYAEK
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgacttttgctgctccctcgaacgacaaggccgagcttgagattggctcggcc
ttcacgccccgcttcgacgagaagggcctggtcaccgctgtagtgaccgacgcccgcgac
ggcgaattgctgatggtcgcgcatatgaatgccgaggcactggcactgacgatcgaaacc
ggtattgcccactatttcagccgctcgcgcaacagcctgtggaagaagggcgagagttcc
ggcaacgtgcaggccgtccaggaaatcaggaccgattgcgatcaggacgccgtctggctg
aaggttaccgttgcaggccatgacgccacctgtcacacgggacgccgctcctgcttctac
cgcacggttggggtcgagggcggtgagccgaaagtaaccatttcggatgaacgcagatac
tttgatccgaagcttgtctacgccgaaaaatag

DBGET integrated database retrieval system