KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c17370Help
Entry
SS05631_c17370    CDS       T05069                                 

Definition
(GenBank) Sorbitol dehydrogenase
Organism
sino  Sinorhizobium sp. CCBAU 05631
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ASY56670
UniProt: A0A249NSH9
LinkDB All DBs
Position
complement(1641870..1642898)
Genome map
AA seq 342 aa AA seqDB search
MKAVRLEAIGKISVRHVEVPEPGPDDLLVKVEACGICGTDRHLLHGEFPSTPPVTLGHEF
CGIVVRAGNSVYGIKPGARITGDPNISCGRCPQCQAGRVNLCLNLRAIGIHRDGGFAEYV
LVPQKQAFEIPLSLDAVHGAFCEPLACCLHGIDNAGIRAGSSVAVLGGGVIGLLTVQLAR
LAGATTVILSTRQASKRGLAEEVGATATVDPTAGDVIEAISGPHGLVPGGVDVVIECAGV
AETVMQSTRLAKAGGTVVILGVLPRGEKVEIEPFGILFRELRLQGSFINPFVHRRAADLV
ATGAIDVDRLISRRVTLDEAPVIIANKALPGEVKVLVIPSSE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggtgcgtctggaagcgatcggcaaaatctccgttcggcacgtcgaggtgccc
gaacccgggcctgacgatctgctcgtcaaagtggaagcctgcggcatttgcgggaccgac
cggcatctccttcatggggagtttccgtccacgcctccggtcaccctcggtcacgaattc
tgcggcatcgtcgtgagggccgggaactccgtttacgggatcaaaccgggagcgagaatc
accggcgaccccaatatttcctgcggccgctgcccacagtgccaagctggcagagtaaat
ctctgcctcaatctgcgcgccatcggcattcaccgcgatggcggtttcgccgagtacgtg
ctggtcccgcagaaacaggccttcgaaattccgcttagcctcgatgcggtgcacggagcg
ttctgtgaacccctcgcctgctgtctgcacggcatagacaacgccggtatccgtgccggg
tcctcggtggcggttctcgggggcggcgttattggtctattgaccgttcaacttgcaagg
ctggcgggtgcgacgacggtcattctctcgacgcggcaggcatcgaagcgcggcttggcg
gaggaggtcggggcgacggcaacggtcgatcccaccgccggcgacgtgatcgaggcgatc
tctgggccgcacgggctcgttcctggaggagtcgatgtcgtgatcgaatgcgccggcgtg
gcagaaacagtgatgcagtcgacacgcctggcgaaggcgggcgggacggtcgtcatactc
ggcgtgctgccgcggggcgagaaggtggagatcgagcctttcggcattctcttccgcgag
ctgcgcctgcaagggtccttcatcaatccctttgtgcaccgccgggcagccgacctcgtg
gccacgggcgcaattgacgtcgaccggctgatttcccggcgcgtgaccctcgacgaggcc
cccgtcatcattgctaacaaagcgctcccaggagaagtaaaagtgctggtgatcccgtct
tctgaatag

DBGET integrated database retrieval system