KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c20900Help
Entry
SS05631_c20900    CDS       T05069                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00061  Fatty acid biosynthesis
sino00780  Biotin metabolism
sino01100  Metabolic pathways
sino01130  Biosynthesis of antibiotics
sino01212  Fatty acid metabolism
Module
sino_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SS05631_c20900
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SS05631_c20900
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SS05631_c20900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sino01004]
    SS05631_c20900
Enzymes [BR:sino01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SS05631_c20900
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SS05631_c20900
Lipid biosynthesis proteins [BR:sino01004]
 Fatty acid synthase
  Component type
   SS05631_c20900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2
Motif
Other DBs
NCBI-ProteinID: ASY57021
UniProt: A0A249NTI5
LinkDB All DBs
Position
1979316..1979648
Genome map
AA seq 110 aa AA seqDB search
MSIPAVKAKLLEGRKGLIVGIANDRSIAWGCARAFHAFGAEVAVTYLNDKARPHVEPLAR
ELDAPLFLPLDVAVPARSRLSSSASRRPGESSTSSSTRSPFRRRMRSAGG
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtccattcccgccgtaaaggccaagcttctcgaaggccgcaagggcctcatcgtcggc
atcgccaacgaccgctcgattgcctggggctgtgcgcgcgcattccatgcgttcggggcg
gaagtcgcggtgacctatctcaacgacaaagccaggccccatgtggagcccctggcgcgc
gagctcgacgcgccgctctttctgccgctggacgtcgccgtgccggccagatcgaggctg
tcttcgagcgcatcgcggagacctggggagagctcgacttcctcgtccactcgatcgcct
tttcgccgaaggatgcgctcggcgggcgggtga

DBGET integrated database retrieval system