KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c24200Help
Entry
SS05631_c24200    CDS       T05069                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00010  Glycolysis / Gluconeogenesis
sino00620  Pyruvate metabolism
sino01100  Metabolic pathways
sino01110  Biosynthesis of secondary metabolites
sino01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS05631_c24200
   00620 Pyruvate metabolism
    SS05631_c24200
Enzymes [BR:sino01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SS05631_c24200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASY57350
UniProt: A0A249NUI2
LinkDB All DBs
Position
complement(2307067..2308575)
Genome map
AA seq 502 aa AA seqDB search
MLHQKILDNPFKHKYGNFIGGEWREPVAGRYFDNTTPVTGGTLCQVARSDAADIELALDA
AHSAKEKWGRTSTTERSNILMRIAARMEDNLELLARAETWDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEVDHDTIAYHFHEPLGVVGQIIPWNFPILMAAWKVAPALAAGNC
VVLKPAEQTPASILVLAELIADLLPPGVLNVVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVLNEDDDYFDKALEDFAMFALNQGEVCTCP
SRALVQESIYDRFMERALKRVEAIRQGNPLDSATMIGAQASGEQLEKILSYIDIGRQEGA
EVLTGGERNVLEGDLSGGYYVKPTVFRGHNRMRIFQEEIFGPVVSVTTFKTEEEALAIAN
DTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNLLVSYSPEALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagattctcgataacccgttcaagcacaaatacggaaatttcatcggc
ggtgaatggcgcgagccggtggccggccgctatttcgacaataccactcccgtcaccggc
ggcacgctctgccaggtggcccgttcggatgccgccgatatcgagctggcgctcgatgcc
gcccattccgcgaaggagaaatggggccggacctcgaccaccgagcgctccaacatcctg
atgaggatcgcggcgcggatggaggacaatctggaacttctggcgcgggccgagacctgg
gacaacggcaaaccgatccgcgagacgatggccgccgacattcctctggcgatcgaccat
ttccgctatttcgccgcctgcatccgggcacaggaagggtcgatcggcgaggtcgatcac
gataccatcgcctatcatttccacgagccgctcggtgtcgtcggacagatcattccctgg
aatttcccgatcctgatggccgcctggaaggtggcgccggcgcttgcggccggcaactgc
gtcgtcctgaaaccggccgagcagacgccggcctcgatcctcgtgctcgcagaactgatc
gctgatctgctgccgccgggcgtgctcaacgtcgtcaacggcttcggcctggaggcgggc
aagccgctggcgaccagcccgcgcatcgccaagatcgcctttaccggcgagacgacgacc
ggccggctgatcatgcagtacgccagccagaacctcatcccggtgacgctcgaactcggc
ggcaagtcgccgaatatcttcttcgccgacgtgctcaatgaggacgacgactatttcgac
aaggcgctcgaagactttgcgatgtttgcgctcaaccagggcgaggtctgcacctgcccg
agccgggcgctggtccaggaaagcatctatgaccgcttcatggagcgggcgctgaagcgg
gtcgaagcaataaggcagggcaatccgctcgatagtgcgacgatgatcggtgcgcaggcg
tcgggcgagcagctcgagaagatcctctcctatatcgacatcggcaggcaggagggcgct
gaagtgctgaccggcggcgagcgcaacgtgctcgagggcgatctctcgggcggctactac
gtcaagccgacggtgttccgcgggcacaacaggatgcgcatcttccaggaggaaatcttc
ggcccggtcgtgtcggtgacgaccttcaagaccgaggaggaggcgctcgcgatcgccaac
gacacgctctatggcctcggcgccggcgtatggagccgcgatgccaaccgctgctaccgc
ttcggccgcgagatccaggccggccgtgtctggaccaactgctaccatgcctatcctgcg
catgccgccttcggcggctacaagcaatcgggcatcggccgcgagacgcacaagatgatg
ctcgaccattaccagcagacgaagaacctgctggtaagctacagccccgaggcgctcggc
ttcttctga

DBGET integrated database retrieval system