KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c34610Help
Entry
SS05631_c34610    CDS       T05069                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00564  Glycerophospholipid metabolism
sino01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sino00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SS05631_c34610
Enzymes [BR:sino01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SS05631_c34610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_3 FAD_oxidored FAD_binding_2 NAD_binding_8 K_oxygenase GIDA
Motif
Other DBs
NCBI-ProteinID: ASY58375
UniProt: A0A249NXT9
LinkDB All DBs
Position
3321795..3323312
Genome map
AA seq 505 aa AA seqDB search
MSEQAIFDVFVIGGGINGCGIARDAVGRGYSVALAEMDDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPYHKGGLRPAWLIRLGLFLYDHIGGRKL
LPATSTLDMTRDPAAAPLKRLFAKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARRGDGRWVVETEDALTGKRETVRARLLVNATGPWVDRVLADAIGKNDVHNVRLVQGSH
IVLRKKFDDPRAYFFQNPDGRIMFAIPYQDDFTLIGTTDRDFTGNPAEVRISDAEIDYLC
RSASEYFSDPVTKDDIVWTYSAVRPLYDDGASKAQEATRDYVLRLEGQTGQAPLLNIFGG
KLTTYRRLAEAALDKIGEAIGAKGGKWTAGSHLPGGDFPAAGYDAEVSKLKAHYPFLAAS
HARRLVRLYGTRAKQLLDNAASEADLGRRFGADLYAAEVDWLIAQEWALRAEDVLWRRTK
LGLKLSRAEVAELEEYMRDAASAAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcaggcaatcttcgacgtctttgtcataggcggcggcatcaacggatgcggc
attgcgcgtgatgcggtcggccggggatattcggtcgcccttgccgaaatggacgacttc
gcctccggcacctcgtccggctccaccaagctcattcatggcggcctgcgctatctcgag
cattacgagttccggctggtgcgcgaggcgctgatggagcgcgaggtgctctgggcaatg
gcgccgcatgtcatctggccgatgcgcttcgttctaccctatcacaagggcggcctgcgg
ccggcctggctgatccgcctcggcctctttctttacgaccatatcggcggccgcaagctg
ctgccggcgacgagcacgctggacatgacccgcgatccggccgccgcgccgctgaagcgc
ctcttcgccaaggccttcgaatattccgacggctgggtcgacgatgcccggctggtggtg
ctgaacgcccgcgatgccgccgaccgcggcgcaaggatcatggcccgcacccgcgtcgtc
tcggcccgccgcggcgacggccgctgggtggtcgaaaccgaggacgcgcttaccggcaag
cgcgaaacggtgcgcgcccgtctgctcgtcaatgccaccggcccctgggtcgaccgagtg
ctcgccgatgcgatcggcaagaacgacgtccacaatgtccgcctggtccagggcagccac
atcgtcctgagaaagaagttcgacgatccgcgcgcctatttcttccagaacccggacgga
cggatcatgttcgccattccctaccaagacgatttcaccctgatcggcaccaccgaccgg
gatttcaccggcaatccggccgaggtgcgcatcagcgacgccgagatcgattatctctgc
agatcggcgagtgagtatttcagcgatccggtgactaaggacgacattgtctggacctat
tcggcggtccgcccgctctatgacgacggggcaagcaaggcgcaggaggcgacgcgcgac
tatgtgctgcgtctcgaaggccagaccggccaggcgccgctcctcaatatcttcggcggc
aagctcacgacctaccggcggctggccgaagcggcactcgataagatcggtgaagcgatc
ggggccaagggcggcaagtggacggccggatcgcatctgccgggcggcgattttccggct
gcgggttacgatgccgaggtctccaaattgaaagcgcactatccctttctggcggcttcg
catgcccgccgactggtgcgcctgtatggcacgcgcgcgaagcagcttctcgacaatgcc
gcaagcgaggccgatctcggaaggcgcttcggagccgatctctatgcggccgaggtcgat
tggctcatcgcacaggaatgggcattgcgtgcggaggacgtgctttggcgccggacaaag
ctgggactgaagctgtcgcgggcggaagtagcggagctggaggaatacatgcgggacgcg
gccagcgccgccgcctga

DBGET integrated database retrieval system