KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c35060Help
Entry
SS05631_c35060    CDS       T05069                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00020  Citrate cycle (TCA cycle)
sino00190  Oxidative phosphorylation
sino00650  Butanoate metabolism
sino01100  Metabolic pathways
sino01110  Biosynthesis of secondary metabolites
sino01120  Microbial metabolism in diverse environments
sino01130  Biosynthesis of antibiotics
sino01200  Carbon metabolism
Module
sino_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sino_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sino_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SS05631_c35060
   00650 Butanoate metabolism
    SS05631_c35060
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SS05631_c35060
Enzymes [BR:sino01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SS05631_c35060
    1.3.5.4  fumarate reductase (quinol)
     SS05631_c35060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer4_7 Fer2 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ASY58420
UniProt: A0A249NXJ4
LinkDB All DBs
Position
complement(3367088..3367867)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSQVNEGKVWPKPVGATNLREYRVYRWNPDDGKNPRIDTYYIDIDDCGPMVL
DGLLYIKNKIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGMEEIKGTVKIYPLPHMP
VVKDLVPDLTNFYAQHRSIEPWLKTVSPTPAKEWRQSHEDRQKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEATGERLDNLEDPFRLYRCHTIMNCAQACPKG
LNPARAIGEIKKMLVERRF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgctctcccgaagaactcgcaggttaatgaaggcaaggtctggccgaag
ccggtcggcgcaaccaatctgcgcgagtaccgcgtctatcgctggaacccggacgacggc
aagaacccgcgcatcgacacctattacatcgacatcgacgactgcggcccgatggtcctg
gacgggctgctgtacatcaagaacaagatcgatccgacgctgacgctgcggcgctcctgc
cgcgagggtatctgcggctcctgtgcgatgaatatcgacggcactaacacgctcgcctgc
accaagggcatggaggagatcaagggcacggtgaagatctacccgctaccgcacatgccg
gtggtcaaggacctggtgccggatctcaccaatttctacgcccagcaccgctcgatcgag
ccctggctgaagacagtgtcaccgacgcctgccaaggaatggcggcagagccacgaggac
cgccagaagctcgacgggctctacgagtgcatcctctgcgcctgctgctcgacctcctgt
ccgagctactggtggaacggcgaccgctatctcggtcccgccgttctcttgcaggcctat
cgttggctgatcgactccagagacgaggcgaccggcgagcggctcgacaatctcgaggat
cctttccgtctttaccgctgtcacacgatcatgaactgcgcccaagcctgtcccaagggg
ctgaatccggccagggcgatcggcgagatcaagaagatgctggtcgagcggcggttctaa

DBGET integrated database retrieval system