KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c35070Help
Entry
SS05631_c35070    CDS       T05069                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00020  Citrate cycle (TCA cycle)
sino00190  Oxidative phosphorylation
sino00650  Butanoate metabolism
sino01100  Metabolic pathways
sino01110  Biosynthesis of secondary metabolites
sino01120  Microbial metabolism in diverse environments
sino01130  Biosynthesis of antibiotics
sino01200  Carbon metabolism
Module
sino_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sino_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sino_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SS05631_c35070
   00650 Butanoate metabolism
    SS05631_c35070
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SS05631_c35070
Enzymes [BR:sino01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SS05631_c35070
    1.3.5.4  fumarate reductase (quinol)
     SS05631_c35070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_oxidored DAO FAD_binding_3 Lycopene_cycl GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: ASY58421
UniProt: A0A249NXK0
LinkDB All DBs
Position
complement(3367886..3369727)
Genome map
AA seq 613 aa AA seqDB search
MASISSPAASGKAYQYVDHAFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTV
AAQGGIAASLQNMTPDSWQWHLYDTVKGSDWLGDVDAMQYLTMEAPKAVYELEHYGVPFS
RNEEGKIYQRPFGGHMQNYGEGPPVQRTCAVADRTGHAILHTLYGQSLRNNAEFFIEYFA
MDLIMAEDGRCTGVVAWNLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMI
ARAGLPLQDMEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASR
DVVSRCMTLEIREGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPI
PVLPTVHYNMGGIPTNYWGEVLNADAQNPGRIAPGLMAVGEAGCASVHGANRLGSNSLID
LVVFGRAAAIRAGQIIDRQESIPALDAAACDRIVERFDRLRHAKGGTPTAVLRDKMQRAM
QEDAAVFRTQESLESGCRRLSEIWKELSDIKVTDRSMIWNSDLVETLELENLMANAITTV
YGAEARKESRGAHAREDYKDGPLGGRDDMNWRKHTLAWVNDAGDVRLEYRPVHTELIADG
IDPKKIEPKARVY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgatcagttcaccggctgcaagcggcaaagcctatcaatatgtcgatcacgcc
ttcgacgtcgtcgtcgtcggcgccggcggggcgggcctgcgcgccaccctcggcatggcc
gaacagggcctcaagaccgcctgcatcaccaaggtcttcccgacgcgctcccacacggtt
gcagcacagggcggcatcgccgcctcgctgcagaacatgacgccggacagctggcagtgg
catctctacgacaccgtcaagggctccgattggctcggcgacgtcgacgccatgcagtac
ctgaccatggaggcgccgaaggcggtctacgagctcgagcactacggagtgccgttctcg
cgcaacgaggaaggcaagatctatcagcggccgttcggcggccatatgcagaattatggc
gaaggtcccccggtgcagcggacctgcgcagtcgccgaccgcaccggccatgcgatcctg
cacacgctctacggccagtcgctcaggaacaacgccgaattcttcatcgaatatttcgcc
atggacctgatcatggccgaggacggccgctgcaccggcgtcgtcgcctggaatctggac
gacggcaccatccatcgcttcgccgcgaagatggtggtgttggcgaccggcggttacggc
cgcgcctatttctcggcgacctcggcgcacacctgcaccggcgacggcggcggcatgatc
gcccgcgccggcctgccgctgcaggacatggagttcgtgcagttccacccgaccggcatc
tacggttcgggctgtctgatcaccgaaggggcgcgcggcgagggcggctatctcgtcaac
tcggaaggcgagcgcttcatggagcgttacgctccgtcggccaaggacctcgcctcgcgc
gacgtcgtctcgcgctgcatgacgctggaaatccgcgaaggccgcggcgtcggcaagaac
aaggatcacatcttcctgcacctcgaccatctcgatccggcggtgctgcacgagcggctg
ccgggcatctcggaatcggcgaagatcttcgccggcgtcgacgtcacccgcgagccgatc
ccggtgctgccgaccgttcactacaacatgggcggcatcccgaccaactactggggcgag
gtgctgaacgccgacgctcagaaccccgggcgcatcgcgcccggcctgatggcggtcggg
gaagccggctgcgcctccgtgcatggcgccaaccggctgggctccaactcgttgatcgac
ctcgtcgtcttcggccgcgccgcggcgatccgcgccggccagatcatcgaccgccaggaa
tcgatcccggcgcttgatgcggccgcctgcgatcgcatcgtcgagcgcttcgaccggctg
cgccatgccaaaggcggtacgccgacggcggtgctgcgcgacaagatgcagcgcgccatg
caggaagacgcggccgtcttccgtacccaggaatcgctcgaatccggctgccggcggcta
tcggaaatctggaaggaactttccgacatcaaggtcaccgaccgctcgatgatctggaat
tccgatctcgtcgagacgctagagctcgagaacctgatggcgaacgctatcaccacggtc
tacggcgccgaagcgcgcaaggaaagccgcggcgcacacgcccgcgaggactacaaggat
ggtccgctcggcggccgcgacgacatgaactggcgcaagcatacgctggcctgggtcaac
gacgccggcgacgtccggctcgagtatcgtccggtgcacaccgagctgatcgccgacggc
atcgatccgaaaaagatcgagccgaaggcgcgggtatactga

DBGET integrated database retrieval system