KEGG   Streptococcus iniae ISNO: DW64_02905Help
Entry
DW64_02905        CDS       T03286                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sio  Streptococcus iniae ISNO
Pathway
sio00473  D-Alanine metabolism
sio00550  Peptidoglycan biosynthesis
sio01100  Metabolic pathways
sio01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sio00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DW64_02905
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DW64_02905
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DW64_02905
Enzymes [BR:sio01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DW64_02905
Peptidoglycan biosynthesis and degradation proteins [BR:sio01011]
 Precursor biosynthesis
  Amino acid ligase
   DW64_02905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AHY17300
LinkDB All DBs
Position
571109..572155
Genome map
AA seq 348 aa AA seqDB search
MAKQTLVLLYGGRSAEREVSVLSAESVMNAINYDKFLVKTYFISQEGEFFKTQSFDQKPL
ASAKLMTNATKDMSQKIKASDIYEKDAVVFPVLHGPMGEDGSIQGFLEILKMPYVGTTIL
SSSVAMDKITTKHVLESAGIPQVAYTVYIEGEDLELAIAESLEKLTFPIFVKPANMGSSV
GISKAETQVELREAIKLALKYDSRILIEQGLVAREIEVGLLGNTQVSSTLPGEVVKDVAF
YDYKAKYVDNKITMAIPAEIEAPIVADMRRYAEQAFRAIGACGLSRCDFFLTEDGKIYLN
ELNTMPGFTQWSMYPLLWENMGMSYSDLIEKLVNLAKEVFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaacattagtattattatatggaggacgttctgctgagcgcgaagtatca
gttctttcagctgaaagcgtcatgaatgctattaattatgacaagtttttggttaagact
tattttatctctcaagaaggggagttcttcaaaacgcaatcatttgatcaaaagccattg
gcctctgctaaattgatgacaaatgcaaccaaggacatgagtcagaaaattaaagccagc
gacatttatgagaaagatgctgttgtttttccagttcttcatggaccgatgggagaagat
ggctcaattcaagggtttttagaaatcttaaaaatgccttatgtgggaacaactattcta
tcatcaagtgttgctatggataaaatcaccacaaaacatgttttagaatcggcaggtatt
ccgcaagttgcttatactgtctatatcgaaggtgaggatttagagttagccattgctgaa
agtttagaaaaacttactttcccaatttttgtcaaaccagcgaatatgggttcttctgtt
ggcatttctaaagctgagacgcaagtagaattaagagaagctattaaattagctcttaaa
tatgatagccgtattttaattgagcaaggactagtggcgcgtgaaatagaagtaggtctt
ttagggaatactcaagtttcttcaactcttcctggtgaagttgttaaagatgttgctttt
tatgattataaagccaaatatgtagacaataagattacaatggcaataccagcagagatt
gaagcaccaattgttgcagacatgcgacgttacgcagaacaagctttcagagcaatcggt
gcttgtggcttgtcacgatgcgatttcttcttaacagaagacggtaagatttacctcaat
gaattaaacaccatgccaggatttactcagtggtctatgtacccactattatgggaaaat
atggggatgagttattctgacttgattgaaaaacttgttaatttagcaaaagaggtcttt
gaaaaacgtgaaagccatctgatataa

DBGET integrated database retrieval system