KEGG   Streptococcus iniae ISNO: DW64_04230Help
Entry
DW64_04230        CDS       T03286                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sio  Streptococcus iniae ISNO
Pathway
sio00010  Glycolysis / Gluconeogenesis
sio00030  Pentose phosphate pathway
sio00051  Fructose and mannose metabolism
sio00052  Galactose metabolism
sio00680  Methane metabolism
sio01100  Metabolic pathways
sio01110  Biosynthesis of secondary metabolites
sio01120  Microbial metabolism in diverse environments
sio01130  Biosynthesis of antibiotics
sio01200  Carbon metabolism
sio01230  Biosynthesis of amino acids
sio03018  RNA degradation
Module
sio_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DW64_04230
   00030 Pentose phosphate pathway
    DW64_04230
   00051 Fructose and mannose metabolism
    DW64_04230
   00052 Galactose metabolism
    DW64_04230
  09102 Energy metabolism
   00680 Methane metabolism
    DW64_04230
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    DW64_04230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sio01009]
    DW64_04230
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sio03019]
    DW64_04230
Enzymes [BR:sio01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DW64_04230
Protein phosphatases and associated proteins [BR:sio01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DW64_04230
Messenger RNA biogenesis [BR:sio03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DW64_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat RGI_lyase
Motif
Other DBs
NCBI-ProteinID: AHY17544
UniProt: A0A1J0MYK2
LinkDB All DBs
Position
851318..852331
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGVNHGYAGLVAGDIFPIDSKGVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDITGTDFTIGFDTAVNTAVEAIDKLRDTSSSHGRAFVVEVMGRNAGDIALWA
GIATGADQIIVPEEEYDMATVVSTMKDDFETKGKNHHIIVLAEGVMSGEEFAKELKAAGC
TNDLRVTNLGHILRGGSPTARDRVLASWMGAHAVELLNQGRGGVAVGIHNEKLVESPILG
TEEEGALFTLAEDGKIIVNNPHKARLDFAVLNRSLSR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggtggtgatgcccctggaatgaatgctgcgatc
agagcagttgttcgtaaagcaatctcagaaggaatagaagtatatggagtaaaccacggt
tatgctggtttagttgccggtgatattttcccaattgactcaaaaggtgttggtgataaa
atttctcgtggaggaacattcctatattctgctcgctatcctgaatttgcacaacttgaa
ggacaattagctggtattgaacaacttaaaaaacacggtattgaaggtgttgtcgttatt
ggtggagatggttcttatcatggtgctatgcgcttaacagaacatggtttcccagctgtt
ggtatcccaggtacaattgacaacgatattactggaacagattttacaattggttttgac
actgcggtaaatactgctgttgaagctattgataaacttcgtgacacatcatcaagtcac
ggtcgtgcatttgttgttgaagttatgggacgtaatgctggtgatattgcactttgggca
ggtattgcgactggtgctgaccaaatcatcgtaccagaagaagaatatgacatggcaaca
gttgtatctacaatgaaagatgactttgaaacgaaaggtaaaaatcaccatatcatcgtc
cttgcagagggtgtgatgagcggtgaagaatttgctaaagaattaaaagcagctggttgt
acaaatgatttacgtgttactaaccttggacatatccttcgtggtggctcaccaactgct
cgtgaccgtgttttagcttcatggatgggggcacacgctgttgaattactcaaccaaggt
agaggtggagtggctgtaggcattcacaatgaaaaacttgttgaaagtccaattttagga
actgaggaagaaggagcactctttactcttgctgaagatggaaaaatcatcgttaataat
cctcataaggcacgtcttgactttgctgtcttaaatcgttcattatcaagataa

DBGET integrated database retrieval system