KEGG   Streptococcus iniae ISNO: DW64_08340Help
Entry
DW64_08340        CDS       T03286                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sio  Streptococcus iniae ISNO
Pathway
sio00220  Arginine biosynthesis
sio00250  Alanine, aspartate and glutamate metabolism
sio00290  Valine, leucine and isoleucine biosynthesis
sio01100  Metabolic pathways
sio01110  Biosynthesis of secondary metabolites
sio01130  Biosynthesis of antibiotics
sio01210  2-Oxocarboxylic acid metabolism
sio01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sio00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DW64_08340
   00290 Valine, leucine and isoleucine biosynthesis
    DW64_08340
   00220 Arginine biosynthesis
    DW64_08340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sio01007]
    DW64_08340
Enzymes [BR:sio01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DW64_08340
    2.6.1.66  valine---pyruvate transaminase
     DW64_08340
Amino acid related enzymes [BR:sio01007]
 Aminotransferase (transaminase)
  Class I
   DW64_08340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AHY18317
LinkDB All DBs
Position
complement(1665426..1666640)
Genome map
AA seq 404 aa AA seqDB search
MKTFNKSSKLEDVAYDIRGPVLEEAERMMANGERILRLNTGNPAAFGFEAPDEVIHDLIV
NARQSEGYSDSKGIFSARKAIMQYCQLKKFPDVDIDDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLAGGKAVHYICDEEADWYPDIDDMKSKITAKTKAIVVINPNNP
TGALYPKEILEAIVELAREHGLILFADEIYDRVVMDGGEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKQHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDDLL
LPGGRIFEQRNFIYKAINDIPGLSAVKPQAGLYIFPKIDRHMYRIDDDEQFVLDLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPRVEELANVQEKITRVLHKYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtttaataaatcgtcaaagttagaagatgttgcctacgatattcgtggacca
gttttggaagaagcagaacgtatgatggcaaatggggaaagaatccttcgtttgaataca
ggaaatcctgccgcctttggttttgaagcaccagatgaagttatccatgatttaattgta
aatgctcgccaaagtgaggggtattctgatagtaaggggattttttcggcacgaaaagcc
attatgcagtactgtcagttaaagaagtttccagatgttgatattgatgatatttatcta
ggtaatggcgtttcagaactgatttccatgtctttacaagccttgcttgatgatggtgat
gaggttttggtgccgatgccggattatcctttgtggacagcttgtgttagtttagctgga
ggaaaggctgttcattatatctgtgatgaagaagctgattggtatccagatattgatgat
atgaagtcaaaaataactgcgaaaacaaaagctatcgttgttattaatcctaataatcct
actggagctctttatcctaaagaaatccttgaagctattgttgaacttgctagagaacat
ggtctaattctttttgctgatgaaatttatgaccgtgttgtcatggatggtggtgagcat
attgcaattgccagtttagcgccagatgttttttgtgtttctatgaatggtttgtcaaaa
tcacatcgcattgccggttttcgtgttggatggatggttttatctggtccgaaacaacat
gttaaaggttatattgaaggacttaatatgcttgctaacatgcgcttgtgttctaatgtt
ttggcgcagcaagttgtgcaaacctcgcttggtgggcgacaatctgtagatgatttattg
cttccaggtggccgtatttttgaacaaaggaactttatttataaagcgattaatgacatt
cctggattgtctgctgttaagccacaggcaggactttatatcttccctaaaattgaccgt
cacatgtatcgtattgatgatgatgagcaatttgttttggatttgctgaaacaagagaag
gtgatgttggtgcatggccgaggttttaactggaaagatcctgatcattttagaattgtt
tatctaccaagagtagaagaactggctaatgttcaagaaaaaattacccgtgtcctacac
aagtataaacgttaa

DBGET integrated database retrieval system