KEGG   Streptococcus iniae ISNO: DW64_09795Help
Entry
DW64_09795        CDS       T03286                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sio  Streptococcus iniae ISNO
Pathway
sio00030  Pentose phosphate pathway
sio01100  Metabolic pathways
sio01110  Biosynthesis of secondary metabolites
sio01120  Microbial metabolism in diverse environments
sio01130  Biosynthesis of antibiotics
sio01200  Carbon metabolism
sio01230  Biosynthesis of amino acids
Module
sio_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DW64_09795
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    DW64_09795
Enzymes [BR:sio01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     DW64_09795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_C Transket_pyr PFOR_II
Motif
Other DBs
NCBI-ProteinID: AHY18578
LinkDB All DBs
Position
complement(1982541..1983476)
Genome map
AA seq 311 aa AA seqDB search
MMRHVKEMRYVYRDFLKTANKINSKVTVLEADLSSSMATNGLAKEFGNRYINVGIMEAEM
VGLAAGLAVKGYKPYLHTFGPFASRRVFDQLFVSLAYAKLNATVIGSDAGVTAEMNGGTH
MPFEEIGLMRLVPNAVVYDVCDDIQFDAVLKQTLTSKAFHYIRTTRKAPKAVYNGDEDFS
KGYVQLRQGPEATIVASGIMVAEALEVADKLAKEGLEVGVIDLFRIKPIHEDIKGLLVGK
PVLTVENHNKIGGVGSAICELLSQETDTPVRRMGVDERFGQVGKMDYLLEVYELTQDHIY
HNIKEFLKDYH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtcacgtaaaagaaatgaggtatgtctatcgtgatttccttaagacagccaat
aagattaatagtaaagtcacagtcttagaagctgatttatcaagttctatggcaacaaat
ggcttagcaaaagaatttggaaaccgttacataaatgtaggaattatggaagcagaaatg
gttggacttgctgcaggactagccgtcaaaggttacaagccatacctgcatacctttggt
ccatttgcttcgcgtagggtctttgatcaactttttgtctccttggcctatgcaaaactt
aatgcgacagttattgggtctgatgctggggttactgctgagatgaatggtggcacacac
atgccttttgaagaaattggccttatgcgactggtgccaaatgctgtggtatatgatgtt
tgtgatgatattcaatttgatgctgttttaaaacaaacccttacaagtaaggccttccat
tatatccgtacgactcgcaaggcaccaaaagctgtttacaatggtgacgaagattttagt
aaaggttatgttcagttgcgtcaaggacctgaagcaaccattgtagcatcaggtattatg
gttgctgaggctcttgaagttgctgataagcttgcaaaagaaggcttagaagtaggtgta
attgatctctttagaatcaaaccgattcatgaggatatcaaaggattactagttggcaaa
ccagttttgactgttgaaaatcataataaaattggaggtgtcggaagtgctatctgtgaa
ttgctgagtcaagaaacagatacaccagttcgacgcatgggtgttgatgaaagatttggc
caagttggtaagatggattaccttttagaagtatatgaattaacacaagaccatatttat
cataatattaaagaatttttgaaggactatcattaa

DBGET integrated database retrieval system