KEGG   Streptococcus iniae ISNO: DW64_09925Help
Entry
DW64_09925        CDS       T03286                                 

Definition
(GenBank) MFS transporter
  KO
K08152  MFS transporter, DHA1 family, multidrug resistance protein B
Organism
sio  Streptococcus iniae ISNO
Brite
KEGG Orthology (KO) [BR:sio00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sio02000]
    DW64_09925
Transporters [BR:sio02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    DW64_09925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3
Motif
Other DBs
NCBI-ProteinID: AHY18602
UniProt: A0A1J0N1R8
LinkDB All DBs
Position
complement(2008778..2010001)
Genome map
AA seq 407 aa AA seqDB search
MSEFFQLPKQIQLRELMRFITITLGSSIFPFMAMYYTTYFGTFMTGILMMITSLSGFLGT
MYGGHLSDAIGRKKVVIIGSIGTIIGWFLTITANIPGHLIPWLTFLGILLVDISSCFYGP
AYEAMLIDLTDSSNRRFVYTINYWLINIAVMFGAGIAGLFYDHYFIELLLAMFVVNLLCF
FVAYYKFHETRPDDHDFAHNSSLSATFKNYSEVFKDRAFVIFTMGSILFSSVWMQMDNYI
PVHLKLYFETTHLFGFEVTGAKMLSIMVFTNTFLIVFFMTLVNKLTVKWKLLPQLLIGSI
IFSVGVFLSFTFTHFIGIWIAVLIFTVGEMINVPANQVLRADMMDQSKIGSYTGFVSMAH
PLGAILAGFLVSLSHFSGPIGVQIMFLVIATAGIYLTLLSARMKKKV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagttttttcaattaccaaaacaaattcaattacgggaattaatgaggtttatt
actattacacttggaagtagtattttcccatttatggccatgtattacacaacttacttt
ggaacatttatgactggtattttgatgatgataacgagtcttagtggttttttgggaacc
atgtatggaggtcacttgtccgatgccattggtcgaaaaaaggttgttatcattggttca
attggtactattattggatggttcttaaccattacagcaaatattccaggacatctcata
ccatggttgacttttttagggattcttctagttgatatttcatcttgtttttatggccct
gcctatgaagccatgttgattgatttgacggatagtagcaatagacgatttgtttatact
attaattattggctgattaatattgcagtgatgtttggtgctggtattgcaggtttattt
tatgaccattattttatagaattattgcttgccatgtttgtggttaatttactttgtttt
tttgtggcatattataaattccatgagacacgtcctgatgaccatgattttgctcataat
tctagtttgtcagcaacctttaaaaattatagtgaggtctttaaagacagagcttttgtt
attttcactatgggttcaatcttgttttcgagtgtttggatgcagatggataattacatt
cctgttcatttaaagttgtattttgaaactacgcatctctttggttttgaagtgacggga
gcaaaaatgctctctattatggtttttaccaatacctttttgatcgtgttttttatgaca
cttgtcaataagttgacagttaaatggaaattgctcccacaattattgataggttctatc
attttttcagttggggtattcttgtcatttaccttcacgcattttattggtatctggatt
gctgttcttatttttacagttggggaaatgattaatgtgccagctaatcaggtgttaaga
gctgacatgatggatcagtcaaagattggttcttatacaggatttgtatcaatggcacat
ccactcggggctattttagcaggttttctagtatcacttagccatttcagtgggcctatt
ggtgtccaaataatgtttctagtgattgctaccgcaggtatttacctaaccctactatct
gcaagaatgaaaaagaaggtttaa

DBGET integrated database retrieval system