KEGG   Streptococcus sp. I-P16: N597_02065Help
Entry
N597_02065        CDS       T02880                                 

Definition
(GenBank) carbohydrate kinase
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
sip  Streptococcus sp. I-P16
Brite
KEGG Orthology (KO) [BR:sip00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    N597_02065
Enzymes [BR:sip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     N597_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AGY37742
UniProt: U5P6P7
LinkDB All DBs
Position
391458..392300
Genome map
AA seq 280 aa AA seqDB search
MLRVDQTLLQQVIVSRQSDSYKGDYGRLLLIGGTYPYGGAIMMSALAAVESGAGLVTVAT
DQENIYALHSQLPEAMAFAVTDQELLADQIAKAGVILLGPGLKDNDLGTHLVQLVFDRVQ
SHQVLILDGGAISIYTRLALPLPQAQLVFTPHQKEWEAMSGLAIGEQGEDRTQMAVGKLP
EGSILVQKGPQTKIWQQGQPDYYQLTVGGPYQATGGMGDTLAGMIAGFAGQFPQVGLYER
VVVATHLHSAISEDLSEEVYVVLPTAISKEIPKWMKKISQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttaagagttgaccaaacattgctgcaacaagttattgttagtcgtcagtcagactcc
tacaagggtgactatggtcgtcttctcttgattggaggaacctacccatatgggggagcg
attatgatgtctgctttggcagctgtggagagtggagcgggtctggtaacggttgcgaca
gatcaggagaacatctatgcactccatagtcagctacccgaagccatggcatttgctgtg
actgaccaagaattattggctgatcaaatcgcaaaagcaggcgttattttattggggcca
ggcctcaaggacaatgatctagggacacaccttgtacagttagtttttgacagggttcag
tctcaccaagtgttgattctagatggcggagcaattagtatctatactcgcttagcgttg
cctcttcctcaagctcagttggtttttactcctcatcagaaagaatgggaggcgatgtca
ggtctagcaattggggaacaaggagaagataggacacaaatggctgtgggaaaacttcca
gaaggatctatcttagttcaaaagggacctcagaccaagatttggcaacaaggacaacca
gactattaccaactaacagttgggggaccttaccaggcaactggaggtatgggcgatacc
ttggcaggcatgattgcaggatttgcaggccaatttccacaggttggactctatgagcgc
gtggtggtggctactcaccttcattcggctatttctgaagacttgagcgaggaagtctac
gtggttttgccgacagcgattagtaaagaaattcccaaatggatgaaaaaaattagccaa
tag

DBGET integrated database retrieval system