KEGG   Streptococcus sp. I-P16: N597_02435Help
Entry
N597_02435        CDS       T02880                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sip  Streptococcus sp. I-P16
Pathway
sip00473  D-Alanine metabolism
sip00550  Peptidoglycan biosynthesis
sip01100  Metabolic pathways
sip01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N597_02435
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N597_02435
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    N597_02435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sip01011]
    N597_02435
Enzymes [BR:sip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     N597_02435
Peptidoglycan biosynthesis and degradation proteins [BR:sip01011]
 Precursor biosynthesis
  Amino acid ligase
   N597_02435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGY37814
UniProt: U5P2A1
LinkDB All DBs
Position
449136..450182
Genome map
AA seq 348 aa AA seqDB search
MAKEKIVLLYGGRSAEREVSVLSAESVMRAINYDMYSVETYFITQAGDFIKTQTFEEKPA
ETERLMTNETIDWDAKVSPSSISQEGAVVFPVLHGPMGEDGSVQGFLEVLKLPYVGCDIL
SSSVAMDKITTKRVLESAGIPQVPYVAVLEGDELEAKIALIEKELTYPVFTKPSNMGSSV
GISKAENQAELRQSLKLAFKYDSRVLVEQGVVAREIEVGLLGNYDVKSTLPGEVVKDVAF
YDYEAKYIDNKITMAIPAEIPAEVVATMRQNAELAFRAIGGKGLSRCDFFYTEDGGIYLN
ELNTMPGFTQWSMYPLLWDNMGLAYPDLIERLVELAKETFEKREAHLL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaaattgtacttctttatggtggccgtagcgcagagcgcgaagtgtct
gtgctttccgctgaaagcgtcatgcgggcgattaattatgacatgtattctgttgagacc
tatttcattactcaggctggggacttcattaagacccaaacttttgaagagaaacctgct
gaaacagaacgcttgatgaccaatgaaaccattgattgggacgctaaagtatctccgagc
agtatctcccaagaaggagcggttgtctttccagtccttcacggaccgatgggagaagat
ggatcggttcaaggtttcctagaagtattgaaactcccttatgtgggatgtgatatcctt
tcttctagtgtggcgatggacaagattaccaccaaacgggtcctagaatctgcagggatt
ccacaagttccttatgtggctgtccttgaaggagatgagctagaagctaagattgcctta
atcgaaaaggaattgacctatccggtctttaccaagccttctaatatgggctctagtgtc
gggatttcaaaagcagagaaccaagcagaactccgtcagtctttgaaattggcctttaaa
tatgatagccgtgttttggttgagcaaggtgtcgtagcgcgcgaaatcgaagtaggattg
ttaggcaactacgatgtcaagagcaccctacctggtgaagtggtcaaagatgtagccttt
tatgactacgaagccaaatacatcgataataagattacgatggcgattccagctgaaatt
cctgcagaagttgtagcgactatgcgtcagaatgccgaattggccttccgtgctattggt
ggcaaaggtctctcccgttgtgatttcttctacacagaggacgggggcatctacttgaat
gagctcaataccatgcctggctttacccaatggtctatgtatcctttactttgggataac
atgggcttggcctatcctgatttaatcgagcgcttggtagaattagccaaagaaaccttt
gaaaagcgcgaagcgcacttactttaa

DBGET integrated database retrieval system