KEGG   Streptococcus sp. I-P16: N597_03090Help
Entry
N597_03090        CDS       T02880                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sip  Streptococcus sp. I-P16
Pathway
sip02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sip00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    N597_03090 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sip02000]
    N597_03090 (pstB)
Enzymes [BR:sip01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     N597_03090 (pstB)
Transporters [BR:sip02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    N597_03090 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_15 AAA_22 AAA_29 RsgA_GTPase AAA_23 AAA_28 AAA_33 NB-ARC cobW AAA_18 AAA_30 AAA_16 Pox_A32 G-alpha AAA_7 ATP_bind_1 Rad17
Motif
Other DBs
NCBI-ProteinID: AGY37939
UniProt: U5P2K1
LinkDB All DBs
Position
584509..585312
Genome map
AA seq 267 aa AA seqDB search
MSKYNWDERHIITFPEEKVVLSTKDLHVYYGNNESIKGVDMQFEKNKITALIGPSGSGKS
TYLRSLNRMNDTIDIARVTGEIWYEGIDVNRPDINVYEMRKHIGMVFQRPNPFAKSIYRN
ITFPHERAGVKDKKVLDEIVEKSLKQAALWDQVKDDLHKSALTLSGGQQQRLCIARAISV
KPEILLMDEPASALDPIATAQLEETMLELKKDYSIIIVTHSMQQAARASDYTGFFYLGNL
IEYDKTSNIFQNAKLQSTNDYVSGHFG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatacaattgggatgagagacacatcattacttttcctgaagaaaaggtggtc
ctatctaccaaagatttgcatgtctattatggaaataacgagtccatcaaaggcgtcgac
atgcagtttgaaaagaataagattacagccttgattggtccctctggatctgggaagtcc
acctatcttagaagtttgaaccgaatgaacgataccattgatattgcgcgtgtgactggt
gagatctggtacgaagggattgatgtaaaccgaccagatatcaatgtctatgaaatgaga
aagcatatcgggatggtcttccaacgaccaaatccatttgcgaagtctatctaccgcaat
attaccttccctcacgaacgggcaggagtcaaagacaagaaggtcttggatgaaatcgta
gaaaaatccttgaagcaagcagccctctgggatcaggtcaaggatgacttgcacaagtct
gctttgacgctctcaggaggtcaacagcaacgcctttgtattgcccgtgccatctccgtt
aaaccagagattttgctcatggatgagccggcttcagccttggacccgatcgcaacagcc
caattggaagaaaccatgctggagttgaagaaggactattcgattatcatcgtgacccac
agcatgcaacaggcggctcgtgctagtgattataccggtttcttctaccttggaaacctc
atcgagtacgataagacttcgaatattttccaaaatgcgaaattgcaatcgaccaacgat
tatgtatcgggtcactttggataa

DBGET integrated database retrieval system