KEGG   Streptococcus sp. I-P16: N597_05785Help
Entry
N597_05785        CDS       T02880                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sip  Streptococcus sp. I-P16
Pathway
sip00500  Starch and sucrose metabolism
sip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N597_05785
Enzymes [BR:sip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     N597_05785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AGY38468
UniProt: U5P4A4
LinkDB All DBs
Position
1124329..1125780
Genome map
AA seq 483 aa AA seqDB search
MENQTLMQYFEWYLPSDGQHWSRLAADAPHLADLGIRKIWMPPAFKATSANDVGYGVYDL
FDLGEFDQKGTVRTKYGFKEDYLQAIQALKEAGIQPMADVVLNHKAAADGLETFEVVEVD
PNDRTIVLTEPFTIKGWTKFTFDGRNGAYNDFHWHWYHFTGTDYDASRNKSGIYQIQGEN
KGWAQDYLVDSENGNYDYLMYADIDFKHPEVIENLNQWAEWFIETTGVQGFRLDAVKHID
SFFMKNFIQQITDKYGEDFYVFGEFWNGDEQSNNDYLASIDYKFDLVDVALHQNLFRASQ
EGENFDLTTIFNGTLASNHPESAVTFVDNHDTQRGQALESTVGEWFKPAAYALILLREAG
LPCVFYGDYYGISGEFAQQDFQAELDQLLRIRKDLAYGEQRDYFDDPNCIGWTRSGTEET
APIACVISNAASSAKRMEIGQVYAGQTYYDALGNYQDTIQIEEDGWADFPVSDRSVSVWV
LAD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaaccttaatgcaatattttgaatggtacttaccttcggatggtcaacac
tggtcccgcttagctgcagatgctcctcacctagcagacttgggtattcgtaaaatttgg
atgcctcctgcttttaaagccacttctgccaatgatgtcggctacggcgtctatgacctc
tttgaccttggagaattcgaccaaaaagggactgttcggaccaaatatggtttcaaagag
gactacttgcaagccatccaagccttaaaagaagctggaatccaacccatggccgatgtc
gttctcaaccataaagcagctgccgacggtttagaaacatttgaagtggtcgaagtggac
cctaacgatcggaccatcgtcttgacagagccttttacgatcaaaggttggacaaaattt
acctttgatggtcgaaatggggcctacaatgacttccactggcattggtaccactttact
ggtaccgattacgatgcttcccgcaataagagtgggatttaccagattcaaggggaaaac
aaaggttgggcacaagactacctcgttgatagtgagaacggaaactacgattacctcatg
tacgccgatatcgactttaaacaccccgaagtgatcgaaaacctcaatcaatgggcagaa
tggtttattgaaacaactggggttcaaggctttcgtctagacgctgttaaacacatcgac
tccttcttcatgaagaacttcatccaacaaattacggacaaatatggagaagatttctat
gtatttggtgagttttggaatggggatgaacaaagcaacaatgactacctagccagcatt
gactacaagtttgacttagtggacgttgccctccaccaaaatctctttagagctagccaa
gaaggggaaaactttgatttaacgactattttcaatggtacacttgcaagtaatcatcca
gaaagtgcggtaacctttgtcgataatcacgatacccaaagaggacaagccttagaatcc
acagttggtgaatggttcaagcctgctgcttacgccctcattctcctccgcgaggctggt
ctcccatgtgtcttttatggagactactacgggatttcaggtgagtttgcccagcaagat
ttccaagcggagcttgatcaactccttcgtatccgcaaagacttagcctacggtgaacaa
agagactactttgacgatcctaactgtattggttggacccgctctggaactgaagagact
gctcctatcgcctgcgtcatttcaaatgctgcttcatccgcaaaacggatggaaatcggc
caagtctatgcaggacagacttactacgacgctttaggaaattaccaagataccatccaa
attgaagaagacggttgggctgatttcccagtctcagaccgctccgtcagcgtatgggtt
ttagcagactaa

DBGET integrated database retrieval system