KEGG   Streptococcus sp. I-P16: N597_07235Help
Entry
N597_07235        CDS       T02880                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sip  Streptococcus sp. I-P16
Pathway
sip00473  D-Alanine metabolism
sip01100  Metabolic pathways
sip01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N597_07235
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    N597_07235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sip01011]
    N597_07235
Enzymes [BR:sip01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     N597_07235
Peptidoglycan biosynthesis and degradation proteins [BR:sip01011]
 Precursor biosynthesis
  Racemase
   N597_07235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-ProteinID: AGY38753
UniProt: U5P504
LinkDB All DBs
Position
complement(1438499..1439626)
Genome map
AA seq 375 aa AA seqDB search
MKASIHRPTRAYVDVEAISYNVQQIQAHIPKETLTFAVVKANAYGHGVQPVVERLLPMVD
VFCVSNLDEAIEVRQVAGEKPILILGVAPIDFIEIAIKEGIRYTVASLEWLKSLLAKKSD
LTGLKLHIKVDSGMGRIGFRSAEDLQEAMILLRNHGAEVEGIFTHFATADEKDDRHFQGQ
LQRFKTLLELLPYTPEIVHASNSATTLWHADTIFNAVRLGDVMYGLNPSGRELELPYNIR
PALSLETELVHVKPLEVGQTVGYGATYQTTEEEWIGTIPIGYADGWTRDMQGFHVLIDGQ
FCPIVGRVSMDQITIRLPKGYPIGTKVVLIGTDGDLDITATDVAVYRGTINYEVVCVLSD
RVPRVYRPTKEVSGK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctagtatacatagaccaacgcgagcatatgtggatgtagaggctatttcctat
aatgttcaacaaatacaggcccatattccgaaagagaccttgacctttgcggttgtcaag
gccaatgcatacggtcatggggttcagccagtggtagaacgcttattgccaatggtagat
gttttttgtgtatccaacctagacgaagccatagaagttcgccaagtagctggcgaaaag
ccgattttaattttgggagttgctccaatagatttcatagagattgccatcaaagaagga
attcgttatacagtggctagtctcgagtggttgaaatctttattagctaaaaagtctgat
ttgactggtttgaagcttcatattaaagtggattcaggaatgggacgaattggtttccgt
tcagcagaagacttgcaagaggctatgatcttattaagaaaccatggggcagaagtggaa
gggatctttacccattttgcaacagctgacgagaaagatgaccgtcatttccaaggacaa
ttgcaacgatttaagaccctgttggagcttttgccctatactccagaaatcgttcacgcc
agcaattcagcaacgactttatggcatgctgataccatttttaatgctgtccgactgggc
gatgtcatgtatggcctcaatccaagtggaagagagttagaactaccttacaatatccgt
cctgctttaagtttggaaacagaattggtgcatgtcaagccactagaggtggggcagaca
gttggctatggagcgacctatcagactactgaggaagagtggattgggacgattccgatt
ggctatgcagatggctggactagagatatgcaaggttttcatgtccttattgatggtcaa
ttctgtccaattgtcggtcgcgtatccatggaccaaatcaccattcgcctacccaagggc
tatccgattgggaccaaggtggtattgattggaacagatggtgatctagatatcacggca
acggatgtagcagtctatagaggcacgatcaactatgaggtggtttgtgtcttgagcgat
cgcgtaccaagagtttatcgtccaacaaaggaagtcagtgggaagtaa

DBGET integrated database retrieval system