KEGG   Streptococcus iniae ISET0901: DQ08_03780Help
Entry
DQ08_03780        CDS       T03285                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
siq  Streptococcus iniae ISET0901
Pathway
siq00010  Glycolysis / Gluconeogenesis
siq00020  Citrate cycle (TCA cycle)
siq00620  Pyruvate metabolism
siq01100  Metabolic pathways
siq01110  Biosynthesis of secondary metabolites
siq01120  Microbial metabolism in diverse environments
siq01130  Biosynthesis of antibiotics
siq01200  Carbon metabolism
Module
siq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:siq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DQ08_03780
   00020 Citrate cycle (TCA cycle)
    DQ08_03780
   00620 Pyruvate metabolism
    DQ08_03780
Enzymes [BR:siq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DQ08_03780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B DUF2344
Motif
Other DBs
NCBI-ProteinID: AHY15594
UniProt: A0A023VQ92
LinkDB All DBs
Position
764252..765667
Genome map
AA seq 471 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMEIEAEETGVLLKIV
RQAGDAVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPNSADAAPAVAPKVETEVPEVAV
AKTAIPQEDGAKVRATPAARRVAAELGINLRQVAGTGPFGRVHQDDVENFKNAQPKASPL
ARKMAEAEGLDLADIKGSGYNGKVMKEDILAAILATKPAQETAKPAAAKEELKAELPEGV
EVIKMSAMRKAISKGMTNSYLTAPSFTLNYDIDMTEMMAFRKKLIDPIMNKTGLKVSFTD
LIGMAVVKTLMKPEHKFLNASLINDAQEIELHEFVNIGIAVGLDGGLIVPVVHGADKMSL
ADFVVASKDVIKKAQNGKLKSNEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATI
PTPTVVNGEIVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMENPFELLI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaaattataatgccaaaactcggtgttgatatgcaagaaggtgaaatcatc
gagtggaaaaaacaagaaggtgatgttgtcaacgagggcgatattcttcttgaaattatg
tctgataaaacaaatatggaaattgaagctgaggagacgggtgttcttttaaaaatcgtt
cgtcaagctggtgatgctgtccctgtaacggaagttattggttacattggagctgaagga
gagtctgtagacacgattgcttcaagtgaaaaaacaactgaaattccagttcctaactca
gctgatgcagcaccggctgttgcgccaaaagtagagactgaagttccagaagttgctgtt
gctaaaacagctatccctcaagaagatggtgccaaagttcgtgcaacacctgctgcaaga
cgtgtagctgcagaacttggtattaacttaagacaagttgctggaacaggtccatttgga
cgtgttcaccaagacgatgttgagaacttcaaaaatgctcaaccaaaagcgtcaccactt
gctcgtaagatggctgaagctgagggtcttgatttggctgacatcaagggaagtggttat
aatggcaaggttatgaaagaagatattcttgctgctattttagctacaaaacctgcacaa
gaaacagctaaaccagcagcagctaaagaagagcttaaagcagaattacctgaaggcgtt
gaagttattaagatgtctgcaatgcgtaaagcaatctctaaaggtatgactaactcatac
ttaacagctccgtcatttacattgaattacgatattgacatgacagagatgatggctttc
cgtaaaaaattaattgatccaatcatgaacaaaacaggtttgaaagtcagctttactgat
ttgattggtatggcagttgtcaaaacattaatgaaacctgagcataagttcctaaatgca
tcattaattaatgacgctcaagaaatcgaacttcatgaatttgttaatattggtatcgcc
gttggtttagacggtggacttattgtaccagttgtacacggtgcagacaaaatgtcactt
gctgattttgttgttgcttctaaagacgttatcaaaaaagcacaaaatggtaagttgaaa
tcaaacgaaatgtcaggatcaacattctcaattacaaacttgggaatgtttggaaccaag
acatttaacccaattattaaccaacctaattctgcaatccttggtgtaggtgcaacgatt
ccaacaccaacagttgttaatggtgaaattgttgcgcgtccaatcatggcaatgtgcttg
accattgaccaccgtatcgtagatggtatgaatggtgctaaattcatggttgatcttaaa
aacttaatggaaaacccatttgaattattaatctga

DBGET integrated database retrieval system