KEGG   Streptococcus iniae ISET0901: DQ08_08355Help
Entry
DQ08_08355        CDS       T03285                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
siq  Streptococcus iniae ISET0901
Pathway
siq00220  Arginine biosynthesis
siq00250  Alanine, aspartate and glutamate metabolism
siq00290  Valine, leucine and isoleucine biosynthesis
siq01100  Metabolic pathways
siq01110  Biosynthesis of secondary metabolites
siq01130  Biosynthesis of antibiotics
siq01210  2-Oxocarboxylic acid metabolism
siq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:siq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DQ08_08355
   00290 Valine, leucine and isoleucine biosynthesis
    DQ08_08355
   00220 Arginine biosynthesis
    DQ08_08355
Enzymes [BR:siq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DQ08_08355
    2.6.1.66  valine---pyruvate transaminase
     DQ08_08355
Amino acid related enzymes [BR:siq01007]
 Aminotransferase (transaminase)
  Class I
   DQ08_08355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AHY16454
LinkDB All DBs
Position
complement(1665968..1667182)
Genome map
AA seq 404 aa AA seqDB search
MKTFNKSSKLEDVAYDIRGPVLEEAERMMANGERILRLNTGNPAAFGFEAPDEVIHDLIV
NARQSEGYSDSKGIFSARKAIMQYCQLKKFPDVDIDDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLAGGKAVHYICDEEADWYPDIDDMKSKITAKTKAIVVINPNNP
TGALYPKEILEAIVELAREHGLILFADEIYDRVVMDGGEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKQHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDDLL
LPGGRIFEQRNFIYKAINDIPGLSAVKPQAGLYIFPKIDRHMYRIDDDEQFVLDLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPRVEELANVQEKITRVLHKYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtttaataaatcgtcaaagttagaagatgttgcctacgatattcgtggacca
gttttggaagaagcagaacgtatgatggcaaatggggaaagaatccttcgtttgaataca
ggaaatcctgccgcctttggttttgaagcaccagatgaagttatccatgatttaattgta
aatgctcgccaaagtgaggggtattctgatagtaaggggattttttcggcacgaaaagcc
attatgcagtactgtcagttaaagaagtttccagatgttgatattgatgatatttatcta
ggtaatggcgtttcagaactgatttccatgtctttacaagccttgcttgatgatggtgat
gaggttttggtgccgatgccggattatcctttgtggacagcttgtgttagtttagctgga
ggaaaggctgttcattatatctgtgatgaagaagctgattggtatccagatattgatgat
atgaagtcaaaaataactgcgaaaacaaaagctatcgttgttattaatcctaataatcct
actggagctctttatcctaaagaaatccttgaagctattgttgaacttgctagagaacat
ggtctaattctttttgctgatgaaatttatgaccgtgttgtcatggatggtggtgagcat
attgcaattgccagtttagcgccagatgttttttgtgtttctatgaatggtttgtcaaaa
tcacatcgcattgccggttttcgtgttggatggatggttttatctggtccgaaacaacat
gttaaaggttatattgaaggacttaatatgcttgctaacatgcgcttgtgttctaatgtt
ttggcgcagcaagttgtgcaaacctcgcttggtgggcgacaatctgtagatgatttattg
cttccaggtggccgtatttttgaacaaaggaactttatttataaagcgattaatgacatt
cctggattgtctgctgttaagccacaggcaggactttatatcttccctaaaattgaccgt
cacatgtatcgtattgatgatgatgagcaatttgttttggatttgctgaaacaagagaag
gtgatgttggtgcatggccgaggttttaactggaaagatcctgatcattttagaattgtt
tatctaccaagagtagaagaactggctaatgttcaagaaaaaattacccgtgtcctacac
aagtataaacgttaa

DBGET integrated database retrieval system