KEGG   Streptococcus iniae ISET0901: DQ08_08745Help
Entry
DQ08_08745        CDS       T03285                                 

Definition
(GenBank) phage infection protein
Organism
siq  Streptococcus iniae ISET0901
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spc7 DUF4201
Motif
Other DBs
NCBI-ProteinID: AHY16524
LinkDB All DBs
Position
complement(1755257..1758262)
Genome map
AA seq 1001 aa AA seqDB search
MKVRKNVRIVWYIVAVILLLGAIVGLNLAIQANNEKGSLAADAHRQTKLDIALVNEDQSI
VSGPNVYNLGTSYVKSIERDDSQNWSVVSRGTAENGLKKGDYQLMLIIPSDFSKKVLDID
NSSADRSIVTYKINTAGNLELEKEATKKGKDIVADLNSQLVDMYMASILSNLYTAQQNVQ
SMMDVQTGNVSTYQKNLYHSATDFQNIFPALLAQSGSSVTANDALKKSLDSYSSMYDGLT
EAQTGFTTSLSKLLEKRAQDKISYEDFTQNLIQMGDLQKQIQPIVQEMQVNQSELMEMMS
KVYKEADADGNEGESTLKSARQTLEELHKTLLKHQSDINENNEKLETFVKEALATYFDQR
HIDDDLTLADFLKKEGNSSQSANAFEKATDNMVTKSLTVLPDSNPANLYGMPSEELSNIT
FDSGLADATGLITGRRNSLARELKENFDAREAAKAAVANINLPSNNQGAGTQTFAISSES
PQVQITSWTVNGESNPSTISSNQENQITVNYNYVADSSNASTTTSASKFTVTIGQMVSTV
SSDDSQKQEAYRNAEAAYQRSLQKVIDAYNTAGSLMSQYYHIGQDGKLNSLTSDFLNQSV
KELLTNLLTQSIKGYLTNPDSVQSEGRIKALLSELENNQEILVEQLASVSTNSRIVSQKI
TDSLAELDNLLKTSKTVEAKNTEVGNADEATTTSIQTLSSQLEALKETTTGAKELAKSNS
EEASQVNTIFSSFNKDVESAQDTGKKLSADAGDLMVAFEKELANNGNFVDSFSKVFNSAY
QNGVPNNVLLDFLAQPVTENASSVKATVNVYRPFTWILLLEVVSLFTAYIFATQNLLKKL
TNRYTVNKFLETDFLNVGIISALALISGLVLGTVSSNSLNVTRELVPSWTLLIVLFSFLL
VHSQYFLLKNLKAIGMGLSLFMIISFVYLSNAIGTVATVKGFPKILKNSNPLSVLEGKLS
AYFDSTSVGFTFLAGIAVLIIALIVANIFITLRLETKAKEH
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttagaaaaaacgtaaggattgtatggtatattgttgcagtcatcttgctctta
ggcgcaattgttggactgaatttggccattcaagccaataatgaaaaaggctcattagca
gcagatgctcacagacaaacaaaactcgatattgcacttgtcaatgaagatcagagtatt
gtttcagggccaaatgtctacaatttaggcacaagctacgtcaaatcaattgaacgtgat
gatagtcaaaactggtccgttgttagccgtggtactgctgaaaatggtctcaaaaaaggt
gattaccaattgatgcttatcattccaagtgatttttcaaaaaaagttcttgatattgat
aatagtagtgctgatagatcaattgttacttataaaattaatactgctggtaaccttgaa
ttggaaaaagaagcgactaaaaaaggaaaagatattgttgctgatttaaatagccaatta
gttgacatgtatatggcaagtattctaagtaacctctatacagctcaacaaaatgtgcaa
tcaatgatggatgtgcaaacaggtaatgtttcaacctatcaaaagaacctctaccattca
gcgacagattttcagaatattttcccagctttattagcacaatcaggaagttcagtaaca
gccaatgacgccttgaaaaaatctctggattcttacagttccatgtatgatgggttaaca
gaagctcaaaccggtttcacgacaagtttgtcaaaactattggaaaaaagagctcaggat
aaaatttcttatgaagattttacacaaaatttaatccaaatgggagatctacaaaaacaa
attcaaccaattgttcaagagatgcaagttaatcaatctgaattaatggaaatgatgtct
aaagtttataaggaagcagatgcagatggtaatgaaggagagtctacacttaaaagtgca
aggcaaacattagaagaactccacaagaccttattgaaacatcagtcagacattaatgag
aataatgaaaagttagaaacttttgtaaaagaagccttggctacttattttgaccagagg
catattgatgacgacctaaccttggcagatttcttaaagaaagaaggcaattcctctcaa
tcagctaatgcctttgaaaaagcaacggataacatggtcactaaaagtttaacagtttta
ccagatagcaatccagccaatctatatggtatgccatcagaggaattaagcaacattact
tttgattctggcctagctgatgcaacaggattaattacgggtcgtcgcaatagtctggca
agagaattaaaagagaactttgatgcgcgtgaagctgcaaaagcagcagtggcaaacata
aaccttccaagtaataatcagggagctggtacacagacgtttgctatctcttcagagtca
ccacaggtgcaaatcacatcttggactgtaaatggtgagtctaatccaagcaccatttca
tcaaatcaagaaaaccaaatcactgttaattataactatgtagctgattcatcaaatgct
tctacaactaccagtgcttctaaatttacagtaaccattggtcaaatggtatcaacggta
tcaagtgatgacagtcaaaaacaagaagcttatcgtaatgctgaagcagcctaccaaaga
agtttacaaaaagttattgatgcctacaacacggcaggatctttaatgagccaatattac
catattggccaagatggtaaactgaatagtttgacatcagatttccttaatcaaagtgtt
aaagaactcctcaccaacctactaactcaaagcattaagggttacctgaccaacccagat
agtgtccaatcagaaggacgaattaaggcattgctttctgaactagaaaataaccaagaa
atattagtggaacaattagcatctgtttctactaatagtagaattgtttcgcaaaaaatt
acagacagtttagcagaattagacaatctcttgaaaacaagtaagaccgttgaggctaaa
aatactgaagttggaaatgctgatgaagcaaccacaacaagcatccaaacactcagcagc
caactagaagccttaaaagaaacaacaacaggtgctaaagagttagctaaaagtaatagt
gaagaagccagtcaagtgaatacaatcttctcaagctttaataaggatgttgagagtgct
caagatactggtaaaaaattatcagctgatgctggtgatttaatggtggcctttgaaaaa
gaattggctaataatggtaattttgttgattcctttagcaaggtctttaattctgcctat
caaaatggcgtgccaaacaatgtattgcttgatttcttagcgcagccggtaacagaaaat
gcctcatcggtaaaagcaactgttaatgtttaccgtccatttacctggattcttctctta
gaagtggttagccttttcactgcttatatctttgcaacacaaaaccttctcaaaaaacta
accaaccgttacaccgttaacaagttcttggaaacagacttccttaatgtaggcatcatt
tcagctttagccttgatcagcggccttgttttaggaactgtttcaagcaatagtttaaat
gtgacccgtgaattggtaccatcatggacactactaattgttctctttagtttcctactt
gttcatagccaatatttccttttgaaaaacctaaaagctattgggatggggctatctctt
ttcatgattattagctttgtttacttatcaaatgctatcggaacagtggcaaccgtcaaa
ggtttccctaaaatcttaaaaaatagcaatccattatcagttttagaaggaaaattatca
gcctactttgatagcacttctgttggctttaccttccttgcgggaattgctgtgctgatt
attgcattaattgttgccaatatttttattaccttacgacttgaaacaaaagcaaaagaa
cactaa

DBGET integrated database retrieval system