KEGG   Streptococcus iniae ISET0901: DQ08_09780Help
Entry
DQ08_09780        CDS       T03285                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
siq  Streptococcus iniae ISET0901
Brite
KEGG Orthology (KO) [BR:siq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DQ08_09780
Enzymes [BR:siq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DQ08_09780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO AlaDh_PNT_C Thi4 FAD_binding_3 NAD_binding_8 NAD_binding_7 K_oxygenase Lycopene_cycl Thioredoxin_4 Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AHY16707
UniProt: A0A3L8GC87
LinkDB All DBs
Position
1975799..1977331
Genome map
AA seq 510 aa AA seqDB search
MALSSDIKKQLEQYLALLESDIVLQVALGHDANSEKVKDFVDEIAAMSTRISVEETQLPR
KPSFKIAQKGKESGVTFSGIPLGHEFTSFILALLQVSGRAPKIDDELVTRIKAIDKPFHF
ETYVSLSCHNCPDVVQAFNIMAVLNPNISHTMIEGGMFQDEVTQKGIMSVPTVFLGQEIF
HSGRATIEELVEKIAGPISADAFANKEIYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETVGIENMIGTLYTEGPKLMAQIEEHTKSYKVDIIRAQLATKIEKKELVEVTLA
NGAVLKAKTAILALGAKWRNMNVPGEEEFRNKGVTYCPHCDGPLFEGKNVAVIGGGNSGM
EAALDLAGLCKHVTVLEFLPEPKADKVLQDRAAKTENVTVLTNVATKDIIGDDHVTGLNY
SDRQTNEEKRLDLEGVFVQIGLVPNTAWLKDSGIALTERGEIIVDGHGATNIPGIFAAGD
CTNSVYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggccctaagttcagacattaaaaaacaattagagcaatacctagcccttttggaatca
gacattgttttacaagttgctcttggtcatgatgctaattctgagaaagtaaaggatttt
gttgacgaaatagctgcaatgtctactcgtatctcagtcgaagaaacacagttgccacgc
aaaccatcctttaaaatcgcacaaaaaggcaaagaaagtggcgtaacattttctgggatt
cccttagggcatgaattcacttcatttatcctagctctcttgcaggtttcaggccgtgct
ccaaaaattgacgatgagttagttacaagaattaaagcaattgacaagccttttcacttt
gaaacctacgtcagcttgtcctgccataattgcccagatgtagtacaggctttcaatatc
atggctgtcttaaaccctaatatcagccacaccatgattgaaggtggaatgttccaagac
gaggttacccaaaaaggcattatgtccgttcctacagtttttcttggccaagaaattttc
cattctggccgtgcaactattgaggaacttgttgaaaaaattgcaggtcctatctctgca
gatgcctttgccaacaaggaaatctatgacgtccttgtcattggcggaggtcctgctggt
aatagtgccgctatctacgcagcaagaaaaggtcttaaaacaggacttttggccgaaact
ttcggtggccaagttatggaaactgttggcattgaaaatatgattggtaccttatataca
gaaggcccaaaattaatggcacaaattgaagaacacaccaaatcttacaaggttgatatt
attagagctcaacttgctaccaaaattgagaaaaaagaattggtggaagtaacactggca
aacggcgctgttctaaaagctaaaacagctatcttagcactaggagctaagtggcgaaat
atgaatgttcctggcgaagaggaattccgaaataaaggagttacttactgtccacattgt
gacggtcctctatttgaaggaaaaaatgtagccgttattggtgggggcaactcaggaatg
gaggctgccctagacttagcaggactctgtaaacatgttaccgttttagaatttttacca
gaacctaaagctgataaagttttacaagatcgtgctgccaaaactgaaaacgtaactgtt
cttacaaatgtagccactaaagacattattggggacgaccatgttactggtcttaactac
agtgaccgtcaaactaacgaagaaaaacgccttgatttagaaggagtctttgttcaaata
ggtcttgtaccaaacactgcttggctcaaagatagtggcattgcgctgacagaacgcggt
gaaattattgtggatggccatggtgcaactaatattccaggaatttttgctgcaggtgac
tgcacaaattctgtttacaaacaaatcattatctcgatgggttcaggtgcaacagctgca
attggtgcatttgattacctcattagacaataa

DBGET integrated database retrieval system