KEGG   Sulfolobus islandicus L.S.2.15: LS215_1600Help
Entry
LS215_1600        CDS       T00889                                 

Definition
(GenBank) lysine biosynthesis enzyme LysX
  KO
K19412  glutamate--LysW ligase ArgX [EC:6.3.2.-]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00220  Arginine biosynthesis
sis01100  Metabolic pathways
sis01210  2-Oxocarboxylic acid metabolism
sis01230  Biosynthesis of amino acids
Module
sis_M00763  Ornithine biosynthesis, mediated by LysW, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sis00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    LS215_1600
Enzymes [BR:sis01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     LS215_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 GSH-S_ATP ATPgrasp_ST ATP-grasp Dala_Dala_lig_C CPSase_L_D2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACP35605
UniProt: C3MQE2
LinkDB All DBs
Position
complement(1481226..1482074)
Genome map
AA seq 282 aa AA seqDB search
MKVALVVDIIRQEEKLIIKALNERQIDYDVINVGQEPIPFNKALSKYDVGIIRPVSMYRA
LYSSAILEAAGVHTINSTDAISTCGDKILTYSKLFRNGIPIPDSIIAASPDAAMKAYEQM
GFPVIDKPPIGSWGRMVSLIRDVYEGKTIIEHREMLNNSALKVHIIQEYIKYKERDIRCI
VIGDELLGCYARNIPPNEWRANVALGGNPTPIQLDDKIRELAVKSVKLVKGEFVSIDILE
HKSKGYVINELNDVPEFKGFMLATGINVAEKLVDHIIRTYRV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtagccttagtagtagatataattagacaagaggagaagttaataataaaggca
ttaaatgaaaggcaaatagactatgacgtaattaatgtaggtcaagaacctattccgttt
aataaagcacttagcaagtatgatgttggaataattagaccagtgagcatgtatagggct
ctttattcatctgcgatcctagaggccgctggtgtgcatacgataaattcaacagacgcc
atcagcacttgcggagataagatactaacatactccaaactatttaggaatgggattcca
ataccggactcaattatagcagcgtctccagatgcagctatgaaagcatatgaacagatg
ggattcccagtaatagataaaccgcctattgggagttgggggagaatggtatctttaata
agagatgtttatgaaggaaaaacaattatagagcatagagaaatgcttaacaattcagcg
ctgaaagtacacataattcaagaatatatcaaatacaaagaaagagatatacgatgtata
gtaataggagatgagctattaggatgctatgcaagaaatattccgcctaacgagtggaga
gctaatgttgcattaggaggaaatcctacacctattcaattagatgataagataagagaa
ttggctgtaaagtctgtaaagttagtaaaaggtgaattcgtgtccatagatatattagag
cacaaatcgaagggatatgttataaacgagctaaatgacgttccagaattcaaaggattt
atgttagcaactggtatcaatgttgccgaaaagttagtagatcatattattaggacctac
cgagtttag

DBGET integrated database retrieval system