KEGG   Ruegeria sp. TM1040: TM1040_3530Help
Entry
TM1040_3530       CDS       T00359                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sit  Ruegeria sp. TM1040
Pathway
sit00020  Citrate cycle (TCA cycle)
sit00190  Oxidative phosphorylation
sit00650  Butanoate metabolism
sit01100  Metabolic pathways
sit01110  Biosynthesis of secondary metabolites
sit01120  Microbial metabolism in diverse environments
sit01130  Biosynthesis of antibiotics
sit01200  Carbon metabolism
Module
sit_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sit_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sit_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TM1040_3530
   00650 Butanoate metabolism
    TM1040_3530
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TM1040_3530
Enzymes [BR:sit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TM1040_3530
    1.3.5.4  fumarate reductase (quinol)
     TM1040_3530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer2 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABF62502
RoseoBase: TM1040_3530
UniProt: Q1GLG4
LinkDB All DBs
Position
mega:564490..565269
Genome map
AA seq 259 aa AA seqDB search
MVEFALPKNSRITTGKTWPKPEGATNVRKFQIYRWNPDDGKNPSVDTYFLDMDKCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGINTLACIYGLDEIKGDVKIYPLPHMP
VVKDLIPDLTHFYAQHASIMPWLETKTNRPAKEWKQSIEDRKKLDGLYECVMCASCSTSC
PSYWWNGDRYLGPAALLHAYRWIIDSRDEATGERLDNLEDPFKLYRCHTIMNCAKTCPKG
LNPAKAIAHIKKLMVERTV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaattcgcacttccgaaaaactccaggatcaccactggcaagacgtggcccaag
cctgaaggcgcaaccaatgtgcgcaagttccagatctaccgctggaacccggacgatggc
aaaaaccccagcgtggacacgtatttcctcgatatggacaaatgcggtccgatggttctg
gacgcgctcatcaagatcaagaacgagatcgacccgacgctgaccttccgccgctcctgc
cgcgagggcatctgtggctcctgtgcgatgaacatcgacgggatcaacacgctggcctgt
atctatggtctcgacgagatcaagggcgacgtgaagatctatccgctgccgcatatgccg
gtggtgaaggaccttattcccgatctcacgcatttctatgcccagcatgcctcgatcatg
ccgtggcttgagaccaagaccaaccgtcccgccaaagagtggaagcagtccatcgaggac
cgcaagaagcttgacgggctttatgagtgcgtgatgtgcgcgtcctgctccacctcctgc
ccgagctactggtggaacggcgaccgttacctcggccctgccgcgctgctgcatgcctat
cgctggatcatcgacagccgcgacgaggcaaccggtgagcgtctcgacaatcttgaagac
ccgttcaagctctaccgctgccacaccatcatgaactgcgccaagacctgccccaaaggc
ctgaaccccgccaaggcgatcgcgcatatcaagaaactgatggtcgaacgcaccgtttga

DBGET integrated database retrieval system