KEGG   Setaria italica (foxtail millet): 101752877Help
Entry
101752877         CDS       T02818                                 

Gene name
PPC1
Definition
(RefSeq) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00620  Pyruvate metabolism
sita00710  Carbon fixation in photosynthetic organisms
sita01100  Metabolic pathways
sita01200  Carbon metabolism
Module
sita_M00168  CAM (Crassulacean acid metabolism), dark
sita_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
sita_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
sita_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    101752877 (PPC1)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101752877 (PPC1)
Enzymes [BR:sita01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     101752877 (PPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 101752877
NCBI-ProteinID: NP_001267742
UniProt: Q6RUV4
LinkDB All DBs
Position
I
AA seq 961 aa AA seqDB search
MASERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYEL
SAEYENDRDEARLGELGSKLTSLPPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIKLKR
GDFADEASAPTESDIEETLKRLVSQLGKSREEVFDALKNQTVDLVFTAHPTQPVRRSLLQ
KHGRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYF
HETIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVC
LLARMMAANLYFSQIEDLMFELSMWRCSDELRIRADELRRSSKRAAKHYIEFWKQVPPNE
PYRVILGDVRDKLYYTRERSRHLLTTGISEIPEEATFTNVEQFLEPLELCYRSLCACGDK
PIADGSLLDFLRQVSTFGLALVKLDIRQESDRHTDVLDSITKHLGIGSYAEWSEEKRQDW
LLSELSGKRPLFGSDLPLTEETADVLGAFHVLAELPADCFGAYIVSMATAPSDVLAVELL
QRECHVKHPLRVVPLFEKLADLKSAPAAVARLFSIDWYMDRINGKQEVMIGYSDSGKDAG
RLSAAWQMYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLR
VTVQGEVIEHSFGEEHLCFRTLQRYTAATLEHGMHPPISPKPEWRALMDEMAIVATKEYR
SIVFQEPRFVEYFRSATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWISAWTQTRFHLP
VWLGFGAAFKHLMQKDIRNIHTLKEMYNEWPFFRVTLDLLEMVFAKGDPGIAAVYDKLLV
AEDLQSFGEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYITTLNVCQAYTL
KRIRDPGFQVSPQPALSKEFTDESQPAQLVQLNPESEYAPGLEDTLILTMKGIAAGMQNT
G
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgagcggcaccagtcgatcgacgcgcagctgcggctgctggcgccaggcaag
gtctccgaggacgacaagctcgtcgagtacgacgccctcctcgtcgatcgcttcctcgac
atcctccaggacctgcacggcccgcacctccgcgaattcgtgcaggagtgctacgagctc
tcggcggagtacgagaacgaccgcgacgaggcgcggctcggcgagctcgggagcaagctc
accagcctgccccccggggactccatcgtcgtcgccagctccttctcgcacatgctcaac
ctcgccaacctcgccgaggaggtgcagatcgcgcaccgccgccggatcaagctcaagcgt
ggggactttgccgacgaggcctcggcgcccaccgagtccgacatcgaggagacgctcaag
cgcctcgtctcgcagctcggcaagtcgcgcgaggaggtcttcgacgcgctcaagaaccag
accgtcgatctcgtcttcacggcgcaccccacgcagcccgtcaggaggtccctgctccag
aagcatggcaggatccggaattgcctgaggcaactgtatgccaaggacatcactgctgat
gacaagcaggagcttgatgaggctcttcagagggagattcaagctgcttttagaactgat
gaaatccgcagaacccctcccactcctcaagatgaaatgcgtgctggaatgagttacttc
catgaaactatatggaagggcgtaccaaaattcttgcgccgtattgacactgctctgaaa
aatattgggatcaatgagcgtctcccttacaatgctcctctcattcagttctcttcctgg
atgggtggtgaccgtgatggaaatccaagagttacaccagaggttacacgggatgtatgc
ttattggcaagaatgatggctgctaacttgtacttctctcagatagaagatctgatgttt
gagctctctatgtggcgctgcagtgatgaacttcggatccgtgcagatgaattacgtcgg
tcatcaaaaagagctgcaaagcactatatagaattctggaagcaagttcctccaaacgaa
ccttatcgtgtcatccttggtgatgtcagggataaactgtactatacgcgtgaacgttct
cgtcatttattgacaactggaatttctgagattcctgaggaggcaacttttactaatgtt
gaacagtttctagaacctcttgagctctgttatagatcattatgtgcctgtggtgacaaa
cccatagccgacggaagtctccttgatttcttgcgtcaagtatccactttcgggcttgct
cttgtgaaacttgacatcaggcaggaatctgatcggcacactgatgtccttgattcaata
actaaacatcttggaattgggtcctatgctgaatggtctgaggagaaacgccaggattgg
ctgttgtctgaactgagcggcaagcgtccattgtttggttctgatcttcctctgactgaa
gagaccgccgatgttttaggcgcatttcatgtcctagcagagctcccagcagattgcttt
ggcgcgtatatcgtctcgatggcaactgccccctccgatgtgcttgctgtcgagctttta
cagcgtgagtgccatgtaaagcatccactgagagttgttccactctttgagaaacttgca
gacttgaagtcagctccagcagctgtagcacgactcttttcaattgactggtacatggat
aggattaatggcaagcaggaggtgatgattggatactcagactctggtaaagacgctgga
cgtctctctgcagcgtggcaaatgtataaagcacaagaggagctcatcaaggtggcaaag
cagtatggagtgaagttgaccatgtttcatggaaggggtggaacagttggcagaggaggt
ggtcccactcatttggccatattatctcagccaccagacacgatacatggatcacttcgt
gtaacagtgcaaggtgaggtcattgagcactcctttggagaggagcacctgtgctttaga
actttgcaacgctacactgcagctacccttgagcatggcatgcatcctccaatttcccca
aagccggaatggcgtgctctgatggatgaaatggctattgtggcaaccaaagaatatcgg
tcaattgtcttccaagaaccacgctttgttgaatacttcagatcggctacacctgagact
gaatatggtaggatgaatattggcagccgtccatcaaagaggaagcctagtgggggaata
gaatcgctccgtgcaattccatggatctctgcttggacgcaaacaaggttccatctccct
gtttggcttggatttggcgcagcattcaagcatctcatgcagaaggacatcaggaacatc
catactcttaaagaaatgtacaatgagtggccattcttcagggttacccttgacttgctt
gagatggttttcgccaagggagacccaggaatcgcggctgtgtatgataaattgctggtg
gctgaagatctgcagtcctttggagagcagctaaggaagaactatgaggagacaaaagag
ctgctccttcaggtcgccggtcacaaggacgtcctcgaaggtgatccttacctgaagcag
cgtctgcggctgcgtgagtcgtacatcaccaccctgaacgtctgccaggcctacaccctg
aagcggattcgtgaccctggcttccaggtgagcccccagccggctctgtccaaggagttc
accgacgagagccagccggcgcagctggtgcagctgaaccccgagagcgagtacgcgccg
ggcctggaggacacgctgatcctgaccatgaagggtatcgccgccgggatgcagaacacc
ggctag

DBGET integrated database retrieval system