KEGG   Setaria italica (foxtail millet): 101754996Help
Entry
101754996         CDS       T02818                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 4A
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sita00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101754996
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101754996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu GRDA
Motif
Other DBs
NCBI-GeneID: 101754996
NCBI-ProteinID: XP_004984367
UniProt: K4AG87
LinkDB All DBs
Position
IX
AA seq 152 aa AA seqDB search
MVKAVVVLGSSEGVKGTIYFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG
PHYNPAGKEHGAPEDDNRHAGDLGNVTAGADGVANIHVTDSQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRIACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgttgtgcttggtagcagtgagggtgtcaagggcaccatctacttc
acccaagagggagatggccccaccactgtgaccggaagtgtctctggcctcaagcctggc
ctccacgggttccatgtgcatgcacttggtgacaccacaaatggctgcatgtcaactgga
ccgcattacaatcctgcgggcaaggagcatggagcaccagaagatgacaaccgccatgct
ggagatctcggaaatgtcacagcgggagcagatggtgttgctaacatccatgttaccgac
agccagatcccactgactgggccgaactcgatcattggcagagctgttgttgttcacgct
gatcctgatgatcttggaaagggtgggcacgagctgagcaagagcactggaaacgctggt
ggccgcattgcctgtgggatcattggactccagggctga

DBGET integrated database retrieval system