KEGG   Setaria italica (foxtail millet): 101755874Help
Entry
101755874         CDS       T02818                                 

Definition
(RefSeq) glutamate decarboxylase 1 isoform X2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00250  Alanine, aspartate and glutamate metabolism
sita00410  beta-Alanine metabolism
sita00430  Taurine and hypotaurine metabolism
sita00650  Butanoate metabolism
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Module
sita_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101755874
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101755874
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101755874
   00430 Taurine and hypotaurine metabolism
    101755874
Enzymes [BR:sita01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101755874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 101755874
NCBI-ProteinID: XP_004973645
UniProt: K3YHA5
LinkDB All DBs
Position
VI
AA seq 495 aa AA seqDB search
MVLSHANSIGRDDAVASTFASRYVRELLPRYRMPDRSIPREAAFQIINDELMLDGNPRLN
LASFVTTWMEPECDKLIMGSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIKEDETAV
GVGTVGSSEAIMLAGLAFKRKWQNRRKEQGKSYDKPNIVTGANVQVCWEKFARYFEVELK
EVKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLTKKNKETGLDV
PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPEE
LIFHINYLGTDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMQNCKANAAVLREGVA
ATGRFDILSKETGVPLVAFSLKDSNHFSVFDISENLRRFGWIVPAYTMPADAEHVAVLRV
VIREDFSRSLSERLVNDIQKILRELDARATHAVRVSSATAAQSDDGVVAKKSVLEIEREV
AARWRNAVNKKTGPC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcacacgccaactccatcggccgggacgacgccgtggccagcaccttcgcg
tcgcgctacgtgcgggagctgctgccgcggtaccggatgccggatcggtcgatcccgcgg
gaggcggcgttccagatcatcaacgacgagctgatgctggacggcaacccgcgcctgaac
ctcgcctccttcgtcaccacctggatggagcccgagtgcgacaagctcatcatgggatcc
atcaacaagaactacgtcgacatggacgagtacccagtcaccacagagctccagaaccgt
tgcgtaaatatgatagctcacctgttcaatgcaccgattaaggaggatgagacggctgtt
ggagttggaacagtgggatcctcagaagcaattatgcttgcaggcctagcattcaagagg
aaatggcaaaacaggaggaaggaacaggggaagtcatatgacaaacccaacattgtcact
ggtgctaatgttcaggtttgctgggagaaatttgcaagatattttgaagtagagctaaag
gaggttaagttatctgaaggatattatgtcatggaccctgtcaaggccgttgagatggtg
gatgagaacactatatgtgttgcggccatcttgggatctactctcaccggggagtttgaa
gatgttaagctattgaatgaccttcttacaaagaagaacaaggaaactgggttggatgtg
ccgattcatgttgacgctgcgagcggaggattcatagcgcctttcctctaccctgagctt
gaatgggacttcaggctaccgctagtgaagagcatcaatgtcagtgggcacaaatatggg
cttgtctacgctggtgttggttgggtaatttggaggagcaaggaagatttgcctgaagag
ctcattttccatataaactacctagggacagaccagcctacattcacgctcaacttctct
aaaggttctagtcagatcattgcacaatactatcagctcattcgcctaggcttcgagggg
tacaagaacataatgcagaactgcaaggcgaacgctgccgttctgcgggaaggcgtcgcg
gcgactggccggttcgacatcctctccaaggagaccggcgtgccgctggtcgccttctct
ctcaaggacagcaaccatttcagcgtgttcgacatctccgagaacctgcggcggttcggc
tggatcgttccggcgtacaccatgccggccgacgcggagcacgtggcggtgctccgcgtc
gtcatcagggaggacttcagccggagcctctccgagcggctcgtgaacgacatccagaag
atcctgcgcgagctggacgcccgcgccacccacgccgtgcgggtctccagcgccaccgcc
gcgcagtcggacgacggcgtcgtggccaagaagagcgtcctagagatcgagcgggaggtc
gccgcgcgatggaggaacgccgtgaacaagaagaccggaccgtgctga

DBGET integrated database retrieval system