KEGG   Setaria italica (foxtail millet): 101758137Help
Entry
101758137         CDS       T02818                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita03030  DNA replication
sita03410  Base excision repair
sita03420  Nucleotide excision repair
sita03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sita00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101758137
   03410 Base excision repair
    101758137
   03420 Nucleotide excision repair
    101758137
   03430 Mismatch repair
    101758137
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sita03032]
    101758137
   03400 DNA repair and recombination proteins [BR:sita03400]
    101758137
Enzymes [BR:sita01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101758137
    6.5.1.6  DNA ligase (ATP or NAD+)
     101758137
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101758137
DNA replication proteins [BR:sita03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101758137
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101758137
DNA repair and recombination proteins [BR:sita03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101758137
   NER (nucleotide excision repair)
    Other NER factors
     101758137
   MMR (mismatch excision repair)
    Other MMR factors
     101758137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 Lactamase_B_2 RMMBL Lactamase_B
Motif
Other DBs
NCBI-GeneID: 101758137
NCBI-ProteinID: XP_012701844
UniProt: A0A368R9D0
LinkDB All DBs
Position
V
AA seq 1393 aa AA seqDB search
MASLLSSPDASKSLSINTSELFLSSLASLPSPHAHPILTSASTPLPPVPAAVPPTALIPG
SRFLIDAFRHAGDFSVAYFLSHFHSDHYGGLAPSWRRGLIFCSAPTARLVSSVLSVPPQL
VVALDLGVRVTVDGWGVTAVDANHCPGAVQFLFSSPGPNTERYVHTGDFRYTESMTHDPY
LLEFVRADAVFLDTTYCNPKFTFPSQEEAVDYVVNAIKHVKDESSAAGKRVLCLIATYVV
GKERILLEVARRCGCSIHVDSRKMEILTVLGFGGENGVFTEDASVTDVHVIGWNVLGETW
PYFRPNFVKMKEIMVERGYMKAVGFVPTGWMYETKKEGFAVRVKDSLEIHLVPYSEHSSY
DELRDYVKFLHPKRVIPTVGVDAGKLDSKEAIAMQKHFSGLVDETANKQEFLMAFHRRST
DATHSCKDVAKCSILHDGEDAALLPAITSASEQLDTLRENITEEMKKELSDFLPSWVSEE
QIMDLLISSGGDVVKAASDFFERERDFFEEANISCSETLKSEKKHTSDHGSSADGSSQQE
CPLFSQKPVEHSTKLVNLTPTGKKPNTPKKEKKRGSGTTNKPKKKGRLTSSTESGGRKQS
TITNYFIRATAATSKSGTADKVTVKAHQNNVESDDQLTDIAKTQDQSVDQLLQIVDGGMS
REYAVSLLEKAKGDVTVAVDIFYSSSENNVTAIDKNIALQNTQNETTDKCSNTDLACDSS
QATPKVSNLHVQTSLAESDSANVSLPIEKYLPIEHACWAAGQPAPYLHLARTFNLVEKEK
GKIKTTAAFCNMFRSLLALSPDDVLPAVYLCTNKISPDHENMELNIGGSLVVSALEESLG
TSRSKIHEMYKTYGDLGNVAQECRQNQTLLAPPRPLSIRDVYSTLRKLSAISGSGSAGRR
KILVLHLIRSCREMEMKFLVRTLVRNLRIGAMMKTILPALAHAVVFDRKCAGDPVVSLEG
IQSQLQSLSTGVAEAYNVIPNLDLLIPSLLSEGTAFSASSLAMVPGTPIPPMLARITNGL
TQSLKAFNGKSFMCEYKYDGQRAQIHRLLDGSVRIFSRQMKESTPRFPDLVNMIKELCRP
EVSSFILDAEVVGVDRKKGNKLMSFQELSSRERGNKHSSIAIDNIKVDICVFVFDIMFCD
GERLLDCPLRQRRKYIHDLFQEKPGYFELAQQLTVEASEASPDNSSTLHRMNTFFKKACE
SSCEGIMLKTLDVDAGYSASKRCESWLKVKRDYVEGLGDSLDLVPVGAWYGNGRKAGWYS
PFLMACYNPETEEFQSVCRVMSGFSDEFYKEMKEFYSGERILLRKPVYYKTDEQPEVWFT
AEQVWEVRGADLTLSPVHHAAIGYVHPSRGISVRMPRYIRSVPDRSPEDCSTVADIATMF
KAQTRKMDVSSEG
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctcctctcctcccccgatgcctccaaatcgctctccattaacacttccgag
ctcttcctatcctccctcgcctcgctcccttcgcctcacgcccaccccatcctcacctcc
gcctccacgccgctcccgcccgtcccagccgctgtgccgcccaccgcactcatcccgggc
tcccgattcctcatcgacgccttccgccacgccggggacttctctgtcgcctactttctc
tcgcacttccactccgaccactacggcggcctagcaccgtcctggcgccgcggcctcatc
ttttgctccgcgcccacggcacgcctcgtctcttccgtgctctccgtgccgccgcagctt
gtcgtcgccctcgatctcggtgtccgtgtgaccgtcgatgggtggggcgtcaccgccgtc
gacgccaaccactgccctggtgccgtccagttcctcttctcctcccctggaccaaacacc
gagaggtatgtgcacactggtgacttccgttacacggagtctatgacgcacgatccttac
ttgctggagttcgtccgtgctgacgctgtgttcctggacaccacatactgcaacccgaag
ttcacattcccttcccaagaggaggccgtggattatgtggtgaatgcgatcaagcatgtg
aaagacgagagttcagcggcaggaaagcgtgtgctgtgtctgatcgcgacctatgtcgtg
ggcaaagagaggattttgctggaggttgcacggcgctgtgggtgctcaatccatgtggac
agtaggaagatggagattttgacagtgttgggctttggtggggagaatggagttttcacc
gaggacgcatcagtaacagatgtgcatgttattgggtggaatgtcttaggggagacatgg
ccctatttccgaccaaattttgtgaagatgaaggagatcatggtggagagaggatacatg
aaggctgtcgggtttgtacctaccgggtggatgtatgaaaccaagaaggaaggttttgct
gttagggtgaaagattcacttgagatccatcttgttccttatagtgagcactcaagctac
gacgagttgcgtgactatgttaaatttttgcacccaaagcgggtgatcccaactgttgga
gtggatgctgggaagctcgacagtaaggaggcaattgcaatgcagaagcatttttctggg
ttggtagacgagacagcaaacaaacaggagttcttgatggcattccatcgtaggtcaaca
gatgctactcatagctgcaaagatgttgctaagtgctcgattctgcatgatggggaggat
gctgctttgttaccagcaatcacttctgcttctgaacaactggatactttgagggagaat
attacagaggaaatgaagaaagaactatcagatttcctgccttcatgggtcagtgaggaa
cagatcatggatctgctgattagctcaggtggtgacgtcgttaaagcagcatctgatttt
tttgagcgggagagagatttctttgaagaagcaaatatttcttgcagtgagacgctcaag
tcagagaaaaaacatacttctgatcatgggtcttctgctgatggaagtagtcagcaagaa
tgtccattattttcacagaagcctgtggaacactctacaaaactggtcaatttgactcct
acgggaaagaaaccgaatacacccaaaaaggaaaagaagaggggttctggcactacaaac
aaaccaaaaaagaaaggacgattaacttcctcaacagaatctggtgggcgcaagcagtcc
acaattacaaattatttcattagagctacagcagccacttctaaaagtggtacagctgat
aaagtaactgtgaaggcacaccaaaataatgtggaaagtgacgatcagctaactgatata
gcaaaaacacaagatcagagtgtagaccagcttcttcagattgtagatggcggcatgtcc
agagaatatgcagtttctttgcttgagaaggcaaaaggagatgtaactgtagcagttgat
atattttacagttcaagtgagaacaatgtaactgccattgataagaatattgcgctgcag
aacacgcaaaatgaaaccacagataaatgtagcaacacagacctggcttgtgattcttct
caggctactccaaaggtgtcaaacttacatgtacaaacttctttagcagaatcagattct
gccaatgtatcgctgccaatcgagaagtatctacctattgagcatgcttgctgggcagca
ggacagcctgcaccatacttgcacttggctcgcacttttaatctggttgaaaaagaaaaa
ggaaagatcaaaactacggcagcattttgcaacatgttcaggagtttgcttgccttatcc
cctgatgatgtgctacctgctgtttatctatgcactaataaaatttctcctgaccatgaa
aatatggaactgaacattggtgggagtcttgttgtatctgctctggaggaatcattaggt
accagcagatctaaaatacatgagatgtacaaaacttatggcgatcttggtaatgttgcc
caagaatgccgtcagaatcaaacattacttgcccctcctcgtcctctctccattcgtgat
gtatattccacacttcggaaactaagtgcaatatcaggtagtgggagtgctggaaggaga
aaaattcttgtcttgcatcttattcggtcttgtagggaaatggagatgaaatttcttgtc
agaacgctggttcgtaacttgcgtatcggggctatgatgaagacgatattacctgcgctt
gcacatgctgttgtttttgatagaaagtgtgcaggagatcctgtggtgtccttggaaggc
atacaatcacaactacagagtctttcaactggagttgctgaggcatacaatgtcattcct
aatctggatctgctcattccttctcttctgagcgaaggcactgcattttcagcttcatcc
ttggcaatggtgcctggcacacctattccacctatgctggcaagaattactaatggattg
acccaatcattgaaagcttttaatggcaaatcatttatgtgtgagtacaagtatgatggt
cagcgtgcccagattcacagattacttgatggatctgtgcgaatattttcgaggcaaatg
aaagaatcaactccaagatttcctgacctagtgaacatgattaaggagttgtgcaggcct
gaggtgtccagctttatactggatgctgaggtggtaggagtcgatagaaagaaaggaaat
aagttgatgtcattccaagagctatcttcaagagaaagaggaaacaagcactcatcaatt
gcaatcgataacataaaggttgacatttgtgtgtttgtttttgacatcatgttctgtgat
ggagagaggctgctggattgtcctcttcggcaaagaagaaagtacattcatgacttgttc
caggagaagccaggatattttgagttagctcagcagctaactgtagaagccagcgaagct
tcaccagacaactctagcactttgcatagaatgaacacatttttcaaaaaggcatgcgag
tcttcttgtgagggtataatgttaaagactttggatgttgatgctggatactctgcttcc
aaacgctgtgaatcatggttaaaggtcaagcgtgactacgtggaaggcttaggtgatagc
cttgacttagttccagtcggtgcatggtatggaaatgggcggaaagctggatggtacagt
ccttttcttatggcatgctacaaccctgaaactgaagagttccaaagtgtatgccgtgtt
atgtctggtttctcagatgagttctataaagagatgaaggagttttattctggggaaagg
atactgctcaggaagcctgtttactacaaaacagatgagcaaccagaggtgtggttcact
gcagaacaagtttgggaggtccgaggcgcagacctcaccctatcgcctgttcaccatgcg
gccattgggtatgtccacccatcgcgtggcatctcggtgaggatgccgaggtacatccgc
tcggttccagatcggagcccagaggattgcagcacggtcgctgatattgccacaatgttc
aaagctcagacccggaagatggatgtcagcagtgagggctag

DBGET integrated database retrieval system