KEGG   Setaria italica (foxtail millet): 101758588Help
Entry
101758588         CDS       T02818                                 

Definition
(RefSeq) probable glutathione S-transferase GSTU1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101758588
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sita02000]
    101758588
Enzymes [BR:sita01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101758588
Transporters [BR:sita02000]
 Other Transporters
  Pores ion channels [TC:1]
   101758588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_N_4 GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 101758588
NCBI-ProteinID: XP_004956602
UniProt: K3ZWQ0
LinkDB All DBs
Position
II
AA seq 225 aa AA seqDB search
MAGEKEEGLQLLDLWVSPFAQRCRIALAEKGLAYEPLEQDLSNKGDLLLRANPVHKKVPV
LLHGGRPVCESLVILQYLDEAFPETPALLPSDPHARAHARFWADYADWKVFECGTRLWKR
KAGSELQLQARREMVEALRILEAELGDKPYLAGEAFGFVDLAIVPFAAWFLGYGRLGEFS
VEEVCPRLAAWGERCGERESVARSLHPPEKVYEFIGYLKDKYGDK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggagaaggaggagggtctgcagctgctggacttgtgggtgagcccgttcgcg
cagcgctgccgcatcgcgctggcggagaaaggcctggcgtacgagcccctggagcaggac
ctctccaacaagggcgacctcctcctccgcgccaaccccgtccacaagaaggtccccgtg
ctcctccacggcggccgccccgtctgcgagtccctcgtcatcctccaatacctcgacgag
gcgttcccggagacccccgccctgctcccctccgatccgcacgcgcgcgcgcacgccagg
ttctgggcggactacgcggactggaaggtgttcgagtgcgggacccggctgtggaagcgc
aaggcggggtcggagctgcagctgcaggcgcggagggagatggtggaggccctgcggatc
ctggaggccgagctcggggacaagccctacctcgccggcgaggcgttcgggttcgtcgac
ctcgccatcgtcccgttcgcggcgtggttcctcggctacgggcgcctcggggagttcagc
gtcgaggaggtgtgcccgagactggcggcgtggggggagcggtgcggcgagagggagagc
gttgccaggagcctgcacccgccggagaaggtgtacgagttcatcggctatctcaaggac
aagtacggtgacaagtag

DBGET integrated database retrieval system