KEGG   Setaria italica (foxtail millet): 101760873Help
Entry
101760873         CDS       T02818                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00040  Pentose and glucuronate interconversions
sita00051  Fructose and mannose metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101760873
   00051 Fructose and mannose metabolism
    101760873
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     101760873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 101760873
NCBI-ProteinID: XP_004974083
UniProt: K3YI96
LinkDB All DBs
Position
VI
AA seq 366 aa AA seqDB search
MGKGCQGSGVAAAGEVEENMAAWLVAKNTLKIMPFKLPPLGPHDVRVRMKAVGICGSDVH
YLREMRIAHFVVKEPMVIGHECAGVIEEVGAGVKHLSAGDRVALEPGVSCWRCRHCRGGR
YNLCEDMKFFATPPVHGSLAHQIVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRAGV
GPETAVLVMGAGPIGLVALLAARAFGAPRVAIVDVDEHRLSVARSLGADAAVRVSPRPDD
VGEEVERIRAALGGAEIDVTLDCAGFSKTVATALGATRPGGKVCLVGMGHNEMTVPLTSA
AIREVDVVGVFRYKDTWPLCIEFLRSGKVDVKPLITHRFGFSQREVEEAFEVSARGRDAI
KVMFNL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggatgtcaagggagcggcgtggcggcggccggcgaggtggaggagaacatg
gcggcgtggctggtcgccaagaacaccctcaagatcatgcccttcaagcttccgcccctc
ggcccccatgatgtccgtgtgcgcatgaaggcagtggggatctgcggcagcgacgtgcac
tacctcagggagatgcgcatcgcgcacttcgtggtgaaggagccgatggtgatcgggcac
gagtgcgcgggcgtgatcgaggaggttggcgccggcgtgaagcacctgtccgccggcgac
cgcgtggcgctggagcccggcgtgagctgctggcggtgccgccactgccgcggcggtcgc
tacaacctgtgcgaggacatgaagttcttcgccacccctcccgtgcacggctcgctggcg
caccagatcgtgcacccggcggacctgtgcttcaagctccccgacaacgtgtccctggag
gaaggcgccatgtgcgagcccctcagcgtgggcgtccacgcgtgccgccgcgccggtgtc
gggccggagacggcggtgctcgtgatgggcgcggggcccatcggcctcgtcgcgctcctt
gccgcgcgggccttcggcgcgccccgcgtggcgatcgtggacgtggacgagcaccggctc
tccgtggcgcggtccctcggcgcggacgcggcggtgcgggtgtcgccgaggccggacgac
gtgggggaggaggtggagcggatccgggcggcgctgggcggcgcggagatcgacgtgacc
ctggactgcgccgggttcagcaagacggtggcgacggcgctgggggcgacgcgccccggg
gggaaggtgtgcctggtggggatggggcacaacgagatgacggtgcccctgacgtcggcg
gcgatccgggaggtggacgtggtgggcgtgttccggtacaaggacacctggccgctctgc
atcgagttcctccgcagcggcaaggtggacgtgaagccgctcatcacccaccgcttcggg
ttctcgcagcgggaggtcgaggaggcgttcgaggtcagcgcgcgcggccgcgacgccatc
aaggtcatgttcaacctctag

DBGET integrated database retrieval system