KEGG   Setaria italica (foxtail millet): 101761749Help
Entry
101761749         CDS       T02818                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00010  Glycolysis / Gluconeogenesis
sita00053  Ascorbate and aldarate metabolism
sita00071  Fatty acid degradation
sita00280  Valine, leucine and isoleucine degradation
sita00310  Lysine degradation
sita00330  Arginine and proline metabolism
sita00340  Histidine metabolism
sita00380  Tryptophan metabolism
sita00410  beta-Alanine metabolism
sita00561  Glycerolipid metabolism
sita00620  Pyruvate metabolism
sita00903  Limonene and pinene degradation
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101761749
   00053 Ascorbate and aldarate metabolism
    101761749
   00620 Pyruvate metabolism
    101761749
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101761749
   00561 Glycerolipid metabolism
    101761749
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101761749
   00310 Lysine degradation
    101761749
   00330 Arginine and proline metabolism
    101761749
   00340 Histidine metabolism
    101761749
   00380 Tryptophan metabolism
    101761749
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101761749
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    101761749
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101761749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101761749
NCBI-ProteinID: XP_004965205
UniProt: K3XW75
LinkDB All DBs
Position
IV
AA seq 549 aa AA seqDB search
MARRAASSLVSRCLLANRAAASAGAAPAVPSALRRPVGTRGLLPGVLQRFSTAAVAEEPI
SPPVQVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDVNRAVAAARKAFD
VGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAAHIEVPMVARLMRYY
AGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTLVLK
TAEQTPLSALYISKLLHEAGLPEGVVNVVSGFGPTAGAALASHMDVDKLAFTGSTDTGKI
VLELAARSNLKPVTLELGGKSPFVIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHE
RIYDEFVEKSKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRSGVDSGATLVTGGD
RLGDKGFYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIERANASQYGLAAGVF
TKSLDTANTLTRALRVGTVWVNCFDVFDAGIPFGGYKQSGIGREKGVDSLKNYLQVKAVV
TPIKNAAWL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcacggagggccgcctcctcgctcgtctcccgctgcctcctcgccaacagggccgcg
gcctctgccggcgccgcgcccgctgtcccctccgcgctccgcaggccagttgggacgcgc
gggctgttgccaggggtccttcagaggttcagcacggcagctgtagcagaggagcccatc
tcgcccccagtccaagtgaactacacaaagctcctcatcaatggcaacttcgttgattcc
gcatccggcaagaccttcccaactctggaccctcgtacgggggaggtgattgctcatgtg
gctgaaggtgacgcagaggacgttaaccgtgctgttgctgcagcccgcaaggcttttgat
gtggggccatggccaaagatgacagcatatgagaggtcccgtatcctgctgcgatttgct
gatttgatcgagaagcacaatgacgagcttgctgctttggagacatgggacaatgggaag
ccatacgagcaagctgcccacattgaagtaccgatggtggcccgtcttatgcgttactat
gctggttgggctgataagatccacgggcttgttgttccggctgacggtccacaccatgta
caggtcttgcacgagccaattggtgttgcaggtcagatcatcccatggaacttcccactt
ctgatgtttgcctggaaagttggccctgctttggcatgtgggaacactcttgtactcaag
actgctgaacaaactcctctatcggctttgtatatctccaagttgttgcatgaggctgga
cttcctgagggtgtcgtgaatgtcgtctctggttttggtcctactgctggtgctgctctt
gctagtcacatggatgttgataagcttgcattcactggatctaccgacaccggaaaaatt
gttcttgagttagccgcaaggagcaaccttaagccagtgacactggagttaggaggcaaa
tctccttttgtcatcatggacgatgctgatgttgaccacgctgttgagcttgctcacttt
gccctgttctttaaccagggacaatgctgctgtgctggatctcgcacgtttgtacatgaa
cgtatttatgatgagttcgtggagaagtccaaagctcgtgcattgaagcgcgtcgttggc
gatccattcaggaaaggtgtagaacagggccctcagattgatgatgagcaatttaacaag
atcttgcgctacattagatctggtgttgacagtggagctacccttgtcactggtggtgat
aggttgggtgacaaaggtttctacatccaaccaacgattttctcagatgtgcaggatggc
atgaagattgctcaagaagagatatttgggcctgtccaatcgatcctcaagttcaaagat
ctgaatgaggttatcgagagggcaaatgcaagccaatacggattggccgctggtgtgttc
accaagagcttggacacggccaacaccctgacacgggcactcagggtcggtaccgtctgg
gtgaactgcttcgacgtcttcgacgccgggatccccttcggtgggtacaagcagagtggc
atcgggagggagaagggcgtcgacagcctgaagaactacctgcaagtgaaggccgttgtc
acccctatcaagaatgccgcctggttgtag

DBGET integrated database retrieval system