KEGG   Setaria italica (foxtail millet): 101761758Help
Entry
101761758         CDS       T02818                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00052  Galactose metabolism
sita00500  Starch and sucrose metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101761758
   00500 Starch and sucrose metabolism
    101761758
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101761758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101761758
NCBI-ProteinID: XP_004966197
UniProt: K3XV70
LinkDB All DBs
Position
IV
AA seq 886 aa AA seqDB search
MGSTPPLSTAHTRVAVLLLLFLLAVVPWPGAAAQGGYRVMSVAGGGGQLSARLELAGDGE
KAELGPDVQRLSLTASLETDSRLHVRITDAEHPRWEVPQDIIPRKAPRDIVLDASTGASP
RSRVLSAATSDLTFTLHASPFRFTVSRRSTGDVLFDTSPSVFFKDRYLELTTALPAARAS
LYGLGEHTKRTFRLQRNDTFTLWNADIAAGNVDLNLYGSHPFYLDVRSASPAGAGNGAGA
AHGVLLLNSNGMDIEYGGSYLTYRVIGGVLDFYFFAGPAPLNVVDQYTQLIGRPAPMPYW
SFGFHQCRYGYKNVADLEGVVAGYAKARIPLEVMWTDIDYMDAFKDFTLDPLNFPAGPMR
QFVDRLHRNGQKYVVILDPGINVNETYGTFIRGMQQDVFLKWNGTNYLGKVWPGNVYFPD
FLNPRAAAFWAREISLFRRTLPVDGLWIDMNEISNFVDPPPLDALDDPPYRINNSGVRRP
INNKTVPASAVHFGGVREYDAHNLYGLLEARATNAALRADTGRRPFVLSRSTFVGSGRYT
AHWTGDNAATWDDLHYSINTMLSFGLFGIPMVGADICGFSGDTTEELCSRWIQLGAFYPF
ARDHSAIGTVRRELYLWETVARSARKALGLRYRLLPYLYTLMHEAHATGAPIARPLFFSY
PKDVQTYGVDRQFLLGRGVLVSPVLEPGATAVDAYFPAGRWFSLFDYSLAVASATGKRVT
LPAPADTVNVHVAGGNILPLQMPALTTSRARQTVFHLLVALAEDGSADGELFLDDGESPE
MAGPRGQWSLVRFTCKAGRGGATVRSHVLHDSYGPSRKLVIGKVVFLGLRSPAPPRELAV
YVNGVRTANSTGRAQGYRMSGALGAAHVAGLSLPVGKEFELKVVMS
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgacgccgccgctgtcgaccgcgcacacgcgcgtcgccgtcctcctcctcctc
ttcctcctcgccgtcgtcccgtggcccggtgcggccgcccagggaggttaccgcgtcatg
tctgtcgccgggggcgggggtcagctgtccgcgcggctggagctcgccggcgacggcgag
aaggccgagctcgggcccgacgtccagaggctcagcctaaccgccagccttgagacggac
agccggctgcacgtccgcatcaccgacgccgaacaccctagatgggaggtcccccaggac
atcatcccccgcaaggcgccgcgtgacatcgtcctcgacgcgagcacgggcgcctcgcca
cgcagccgcgtcctctccgcggcgacctccgacctgaccttcaccctccacgcctccccg
ttccgcttcaccgtctcccgccgctccacgggggacgtcctcttcgacacctccccgagc
gtcttcttcaaggaccggtacctcgagctcaccacggcgctccccgccgcccgagcgtcg
ctctacgggctcggggagcacaccaagcgcacgttccggctgcagcgcaacgacacgttc
acgctctggaacgctgacatcgccgctggcaacgtcgacctcaacctctacgggtcccac
ccgttctacctcgacgtgcgctcggcgtcccccgccggcgccgggaacggcgccggcgcg
gcgcatggcgtgctcctgctaaacagcaacggcatggacatcgagtacggcgggtcgtac
ctcacgtacagggtcatcggcggcgtgctcgacttctacttcttcgccggcccggcaccc
ctcaacgtcgtcgaccagtacacccagctcatcggccgcccggcccccatgccgtactgg
tcattcgggttccaccagtgcaggtacgggtacaagaacgttgctgacctggaaggcgtg
gtggccggctacgccaaggccaggatcccgctggaggtgatgtggacggacatcgattac
atggacgcgttcaaggacttcaccctggacccgctgaacttcccggccggcccgatgcgg
cagttcgtcgaccgccttcaccggaacggccagaaatacgtcgtcatcctagacccaggg
atcaacgtgaacgagacgtacgggacgttcatccgggggatgcagcaggacgtgttcctg
aagtggaacggcaccaactacctcggcaaggtgtggccgggcaacgtctacttcccggac
ttcctcaacccgcgcgccgccgcgttctgggcgcgggagatctccctgttccggcggacg
ctccccgtcgacgggctctggatcgacatgaacgagatctccaacttcgtcgacccgccg
ccgctggacgcactggacgacccgccgtaccgcatcaacaactccggcgtgcgccgcccc
atcaacaacaagaccgtgccggcgtccgcggtgcacttcggcggcgtccgcgagtacgac
gcgcacaacctctacggcctcctcgaggcgcgagccacgaacgccgcgctgcgcgccgac
accggccgccgccccttcgtgctcagccggtccacgttcgtcggctccggccgctacacc
gcgcactggaccggcgacaacgccgcgacgtgggacgacctccactactccataaacacc
atgctcagcttcgggctcttcggcatccccatggtcggcgccgacatctgcggcttcagc
ggcgacaccaccgaggagctctgcagccgctggatccagcttggcgccttctacccgttc
gcgagggaccactcggcgatcggcaccgtccggcgggagctgtacctgtgggagacggtg
gcgcggtcggcgaggaaggcgctcggcctgcgctaccggttgctgccgtacctgtacacg
ttgatgcacgaggcgcacgccacgggggctcccatcgcgcggccgctcttcttctcctac
cccaaggacgtgcaaacctacggggtggaccgccagttcctgctcggccgcggcgtgctc
gtgtcgccggtgctcgagccgggggcaaccgccgtcgatgcctacttccccgctggccgg
tggttcagcctcttcgactactccctcgccgtcgcctcggccaccggcaagcgcgtgacg
ctcccggcccccgccgacacggtgaacgtgcacgtcgccggcggcaacatactgccgctg
cagatgccggcgctgaccacgtcgcgcgcgcgccagaccgtgttccacctcctggtcgcg
ctcgccgaggacggctcggcggacggggagctgttcctggacgacggcgagtcgccggag
atggccgggccgcggggccagtggagcctggtgcggttcacctgcaaggcggggcgcggc
ggcgccacggtgaggtcgcacgtgctgcacgactcgtacgggccgagccggaagctggtc
atcgggaaggtggtgttcctgggcctgcgctcgccggcgccgccgagggagctcgccgtg
tacgtcaacggcgtcaggacggccaactcgaccggccgcgcccaggggtaccggatgagc
ggggcgctcggcgccgcccacgtggcggggctgtcgctgcccgtcggcaaggagttcgag
ctcaaggttgtcatgtcataa

DBGET integrated database retrieval system