KEGG   Setaria italica (foxtail millet): 101763632Help
Entry
101763632         CDS       T02818                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00630  Glyoxylate and dicarboxylate metabolism
sita00710  Carbon fixation in photosynthetic organisms
sita01100  Metabolic pathways
sita01200  Carbon metabolism
Module
sita_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sita_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
sita_M00532  Photorespiration
sita_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101763632
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101763632
Enzymes [BR:sita01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101763632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 101763632
NCBI-ProteinID: XP_004962302
UniProt: K3ZA94
LinkDB All DBs
Position
III
AA seq 168 aa AA seqDB search
MAPTVMASSATSVAPFQGLKSTAGLPVSRRSISTGFVSNGGRIRCMQVWPAEGNKKFETL
SYLPPLSTDEVLKQIDYLIRKNWIPCLEFSKIGFVYRENSTSPCYYDGRYWTMWKLPMFG
CTEATQVYAEFEECKKAYPDCYIRIIGFDNIKQVQCVMFIAYKPPGSE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaccgtgatggcctcgtcggccacctcagttgctccattccaggggctcaag
tccaccgccggactccccgtgagccgccgctccatcagcaccggcttcgtcagcaacggc
ggaaggatcaggtgcatgcaggtgtggccggcggagggcaacaagaagttcgagaccctc
tcctacctgccacctctctccacggacgaggtcctgaagcagatcgactacctgatccgg
aagaactggatcccctgcctcgagttcagcaagatcgggttcgtctatcgtgagaacagc
acgtctccctgttactacgacgggcgctactggaccatgtggaagctgcccatgttcggc
tgcaccgaggccacccaggtgtacgctgagttcgaggagtgcaagaaggcctaccccgac
tgttacatccgtatcatcggcttcgacaacatcaagcaggtgcagtgcgtcatgttcatc
gcctacaagcccccgggcagcgagtag

DBGET integrated database retrieval system