KEGG   Setaria italica (foxtail millet): 101763713Help
Entry
101763713         CDS       T02818                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00010  Glycolysis / Gluconeogenesis
sita00020  Citrate cycle (TCA cycle)
sita00620  Pyruvate metabolism
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
sita01200  Carbon metabolism
Module
sita_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101763713
   00020 Citrate cycle (TCA cycle)
    101763713
   00620 Pyruvate metabolism
    101763713
Enzymes [BR:sita01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     101763713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118
Motif
Other DBs
NCBI-GeneID: 101763713
NCBI-ProteinID: XP_004973500
UniProt: K3YHG0
LinkDB All DBs
Position
VI
AA seq 473 aa AA seqDB search
MATAPAPFSLSTSTLPARLRAAAVPAGARGRQPRRGRMVVRAKIREIFMPALSSTMTEGK
IVSWSAAEGDRVTKGDAVVVVESDKADMDVETFHDGIVAAVLVPAGESAPVGAPIALLAE
SEEEVPLALAKAKELSNGQSQQAAPAPAEEAAATPPPPPPPTPAAAPAPVAAGTKGIASP
QAKKLAKQHRVDLAKVTGTGPYGRITPGDVEAAAGIQPKPKPAAVAAASPPVAAPSAAAV
PQAAVLPPVPGATVVPFTTMQAAVSKNMVESLAVPAFRVGYPIVTDKLDELYEKVKPKGV
TMTVLLAKAAAMALAQHPAVNASCRDGKSFTYNSNINIAVAVAIDGGLITPVLQDADKLD
IYLLSQNWKDLVKKARAKQLQPNEYSSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGAS
KPTVVADKDGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFAKIIEDPESLTL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggccccggcacccttctcgctgtccacctccaccctgcccgcgcgcctccgg
gccgcggcggtgccggcgggcgcgcgcggcaggcagccgcggcgcggacggatggtggtg
cgcgccaagatccgggagatcttcatgccagcgctgagctccaccatgacggagggcaag
atcgtctcctggtccgccgccgagggcgaccgcgtcaccaagggcgacgccgtcgtcgtc
gtcgagtccgacaaggccgacatggacgtcgagaccttccacgacggcatcgtggcggcg
gtcctcgtcccggccggggagtccgcgccggtgggggcgcccatcgcgctgctcgcggag
tccgaggaggaggtgccgctcgccctcgccaaggccaaggagctctccaacgggcagtcg
cagcaggcggcgcctgctccggcggaggaggccgccgcgacgccgcccccgcctccgcct
ccgacgccggcggctgcccccgcgccagtggccgccgggacgaagggcattgccagcccg
caggctaagaagctcgcgaagcagcacagggtggaccttgccaaggtgaccggcaccggg
ccgtacggtagaattacgcctggggatgttgaggcggccgccggaatccagccgaagcca
aagcctgctgctgttgctgctgcatcaccacctgtggctgcaccttcagctgctgcagtg
cctcaagcagcagtgctaccaccggtgcctggcgcgactgttgttccattcactaccatg
caggccgcggtgagcaagaacatggtggagagcctggcggtgcccgcattccgtgtcggg
tacccaattgtaactgataagctcgatgagctgtatgaaaaggttaagccaaagggtgtg
acaatgactgtgctactggcgaaggccgcggccatggcgcttgctcagcaccctgctgtc
aatgctagttgcagggatggaaagagcttcacttacaacagtaacatcaacatcgcagtg
gccgtggcaattgatggtggccttattacacccgtcctgcaggatgctgacaagctggat
atctatttgctctcacaaaattggaaggatctagtcaaaaaggcacgcgcaaaacagctc
caaccaaatgagtacagctccgggacatttacactgtccaacctgggtatgtttggtgta
gatagatttgatgcaattcttccacctggccagggagctattatggcagttggagcctcg
aaacctacagttgtggctgataaagatggtttctttagtgtcaagagcaaaatgctggtc
aatgtcactgctgatcacaggattgtatatggtgctgatttggcagcattcctgcagact
tttgcaaagattattgaggatcctgagagcttaacgttgtaa

DBGET integrated database retrieval system