KEGG   Setaria italica (foxtail millet): 101767641Help
Entry
101767641         CDS       T02818                                 

Definition
(RefSeq) alpha-amylase isozyme 3D
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00500  Starch and sucrose metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101767641
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101767641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 101767641
NCBI-ProteinID: XP_004973671
UniProt: K3YHS0
LinkDB All DBs
Position
VI
AA seq 432 aa AA seqDB search
MKHSSSLGLLFLLALCSLVQAQVLFQGFNWESCKKQGGWYNSLKAKVDDIAKAGVTHVWL
PPPSHSVSPQGYMPGRLYDLDASKYGTAAELKSLIAAFHRRGIQCVADIVINHRCADKKD
ARGVYCIFEGGTPDERLDWGPGMICSDDTQYSDGTGHRDTGEGFAAAPDIDHLNARVQRE
LSAWLNWLKSDVGFDGWRLDFAKGYSPAIAKMYVKNTRPSFVVAEIWNSLSYNGDGKPSP
NQDQRRQELVNWVQAVGKPAMAFDFTTKGLLQAGVQGELWRLRDSSGKAAGLIGWTPEKA
VTFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEISTLTAIR
ARNGIHAGSKLRILLADDDAYVAVVDEKVMVKIGTRYDVGNVIPSDFHPAAHGKDYCVWE
KGTLRVPAGLHL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaagcactcgagcagcttgggattgctcttcctcctggcgctctgcagcctggtccag
gcacaggtcctcttccaggggtttaactgggagtcgtgcaagaagcagggcggctggtac
aatagcctcaaggccaaggtcgacgacatcgccaaggccggcgtcacgcacgtctggctg
cctcctccctcgcactccgtctccccacaaggttacatgccagggcgcctgtacgatctg
gacgcgtccaagtacggcacggcggcggagctcaagtccctgatcgcggcgttccaccgc
aggggcatccagtgcgtggcggacatcgtcatcaaccaccggtgcgcggacaagaaggac
gcgcgcggcgtctactgcatcttcgagggcgggacgcccgacgaacgcctcgactggggc
cccggcatgatttgcagcgatgacacgcagtactcggacggcaccggccaccgcgacacc
ggcgaggggttcgcagctgcgcccgacatcgaccacctcaatgcgcgcgtccagcgggag
ctctctgcctggctcaactggctcaagtccgacgttggcttcgatggctggcgcctcgac
ttcgccaagggttactccccggcgattgccaagatgtacgtcaagaacaccaggccaagc
ttcgtcgtggccgagatttggaactccctaagctacaacggtgacggcaagccgtcgccg
aaccaggaccagcgccggcaagagctggtgaactgggtgcaagcggtcggcaagccggcg
atggcgttcgacttcaccaccaaggggctgctgcaggcaggcgtgcagggcgagctgtgg
cggctgcgcgacagctctggcaaggcagccggcttgattgggtggaccccagaaaaggcc
gtcacgttcattgacaaccacgacactggatcgacgcagaagttgtggccattcccgtcc
gacaaggtcatgcagggctacgcctacatcctcacccatcctggggtcccctgcatcttc
tacgaccacatgttcgactggaacttgaagcaggagatatcgacactgactgcgatcagg
gctcgcaacggcatccacgccgggagcaagctgcggatcctcctggccgacgatgacgcg
tacgtggccgtcgtcgacgagaaggtcatggtgaagatcgggacaaggtacgacgtgggc
aatgtgatcccgtcggatttccaccccgcggcgcatggcaaggactactgcgtatgggag
aaggggacactccgcgtcccagcagggctgcacctttag

DBGET integrated database retrieval system