KEGG   Setaria italica (foxtail millet): 101767820Help
Entry
101767820         CDS       T02818                                 

Definition
(RefSeq) beta-galactosidase 8 isoform X2
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00052  Galactose metabolism
sita00511  Other glycan degradation
sita00531  Glycosaminoglycan degradation
sita00600  Sphingolipid metabolism
sita00604  Glycosphingolipid biosynthesis - ganglio series
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101767820
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101767820
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    101767820
   00604 Glycosphingolipid biosynthesis - ganglio series
    101767820
   00511 Other glycan degradation
    101767820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sita04147]
    101767820
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     101767820
Exosome [BR:sita04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101767820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 OxoDH_E1alpha_N
Motif
Other DBs
NCBI-GeneID: 101767820
NCBI-ProteinID: XP_004961372
UniProt: K3Z4C7
LinkDB All DBs
Position
III
AA seq 671 aa AA seqDB search
MASSGTFQNLLLAPLLCLALASSVGGEASSSRRFWIENDTFMKDGAPFQIVGGDVHYFRI
VPEYWKDRLLRAKALGLNAIQTYVPWNLHEPEPQSWEFKGFADIESYLRLAQELDMLVML
RVGPYICGEWDLGGFPPWLLAIEPALKLRSSDSTYLSLVERWWGVLLPKVAPLLYNNGGP
VIMVQIENEFGSFGDDKNYLHYLVQLARRYLGNNIVLYTTDGGAIGNLKNGSIPQDDVFA
AVDFGTGSNPWPIFRLQKKYNLPGKSAPLSSEFYTGWLTHWGESIATTDAASTAKALKTI
LCHNGSAVLYMAHGGTNFGFYNGANTGQDESDYKADLTSYDYDAPIKEHGDVHNSKYEAL
RRVIHKCTRTPLHPLPSDIEKANYGLVKLQKVASLFDIIDNISDPLKGAVSEHPLYMEQI
GQMFGFLLYMSEYQGKLPSSILSIPKVHDRAQVFLSCSTDGIRNPRYAGIIERWSSKTLE
IPNLRCSSNTSLYILVENMGRVNYGPYIFDRKGILSPIQIDGITLRHWKMYPLTFSSLDN
LPKLQLITQMPDVRDSKVSIIHGDSEKKLQESSFYSNEPEFYEGHFHIDSESEIKDTFIS
FRGWNKGVAFVNNFNIGRFWPAWGPQCALYVPAPILRPGDNTIVIFELHGPNPELTINLV
TDPDFTCGPNQ
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggcctccagtggaacctttcagaaccttctcctggcgcccctcctctgcctcgcgctc
gcctcgtcggtcggtggcgaggcgtcgtcgtcaagaaggttctggatcgagaacgatacc
ttcatgaaggatggggcgccgttccagatcgtcggcggggacgtgcactacttccgcatt
gttcctgagtactggaaggatcgcctgttaagagcaaaggcgctgggcttgaacgcaatt
caaacatatgtaccttggaacttgcatgagccagaaccacagagctgggaattcaagggc
tttgcagatattgaatcatatctgagacttgctcaagaattagatatgctggtcatgctt
cgtgtaggtccatacatttgtggagaatgggacttaggaggatttccaccttggttgctc
gccatagaacctgcccttaaactacgatcatcagattcgacctatctttccttggtggag
agatggtggggtgtactacttccaaaagttgcaccattattgtacaacaatggaggtcca
gttattatggttcagattgaaaatgaatttggttcatttggagatgacaagaattacctt
cattaccttgttcaactggccagaagatatcttgggaacaacattgttctttatacaact
gatgggggcgccattggtaatttaaagaacggatcaattcctcaagatgatgttttcgct
gctgttgattttggaactgggtccaatccatggcccatattcagattacagaagaaatac
aacttaccaggaaaatcagctcctttaagttcggaattttatactggatggctaacacac
tggggtgaaagtatagcaacaacagatgccgctagtacagctaaagcccttaaaacaatt
ttgtgccacaatggttctgctgtactttatatggctcatggtgggaccaattttgggttt
tataatggtgcaaatactggccaagatgaatcagattacaaggcagacctcacttcatat
gactatgatgcaccgattaaggagcatggagatgtacataattcaaaatacgaagcactg
agaagggtaatacataaatgtactcggactcctcttcatccacttccttctgacattgaa
aaggcaaattacgggcttgtgaagttacagaaggttgcttctttgtttgacatcattgat
aatatcagtgatcctttgaaaggtgctgtttctgagcatccactgtatatggaacagata
ggccagatgtttggatttctattgtacatgtcagaataccaagggaaactcccatcaagc
atcctatcaattccaaaggtacatgacagagctcaggtgttcctgtcatgctcaactgac
ggtatcagaaacccaagatatgctggtataattgaaagatggtctagtaaaacactagaa
ataccaaatttaagatgttcttctaataccagcctatatatcctggtagaaaatatgggt
cgtgtaaattatgggccatatatttttgaccggaagggaatactatctcctattcaaata
gatggcatcactctccgtcactggaaaatgtatccacttacatttagttcactggataac
cttccaaaactccaactaatcactcaaatgcctgatgttagagatagtaaagtgtccatt
attcatggtgactcagaaaagaaattgcaggagtcatcattctattcaaatgaacctgaa
ttttatgaaggccatttccatatcgactcggagagtgagataaaggatacatttatatca
tttcgtggttggaacaagggtgttgcttttgtgaacaacttcaacattgggagattttgg
ccggcttggggaccacagtgtgccctttatgttcctgctccgatcctcagacctggagac
aacactattgtaatctttgaactgcacggtccgaatcctgaactcacaatcaacttagta
acagatccagatttcacatgcggtccaaatcagtaa

DBGET integrated database retrieval system