KEGG   Setaria italica (foxtail millet): 101767913Help
Entry
101767913         CDS       T02818                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 1
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00220  Arginine biosynthesis
sita00250  Alanine, aspartate and glutamate metabolism
sita00260  Glycine, serine and threonine metabolism
sita00630  Glyoxylate and dicarboxylate metabolism
sita00710  Carbon fixation in photosynthetic organisms
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
sita01200  Carbon metabolism
sita01210  2-Oxocarboxylic acid metabolism
sita01230  Biosynthesis of amino acids
Module
sita_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
sita_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101767913
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101767913
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101767913
   00260 Glycine, serine and threonine metabolism
    101767913
   00220 Arginine biosynthesis
    101767913
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sita01007]
    101767913
Enzymes [BR:sita01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101767913
    2.6.1.4  glycine transaminase
     101767913
    2.6.1.44  alanine---glyoxylate transaminase
     101767913
Amino acid related enzymes [BR:sita01007]
 Aminotransferase (transaminase)
  Class I
   101767913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101767913
NCBI-ProteinID: XP_004955317
UniProt: K3ZSX0
LinkDB All DBs
Position
II
AA seq 478 aa AA seqDB search
MARKPLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGLMFPADAIARAKHYLSLATGGLGAYSDSRGIPGIRKEVADFI
QRRDGYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSATISLFGGSLV
PYYLEEEANWGLDFVNIRKTVAEARSKGITVRAMVIINPGNPTGQCLSEANIKEVLQFCY
HENLVLLADEVYQQNVYQDERPFISAKKVLFDMGPPLSREVQLVSFHTVSKGYWGECGQR
GGYFEMTNLPPQTVDEIYKVASIALSPNVPGQIFMGVMVNPPKPGDISYLKFAAESKSIL
DSLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKAPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKNFNDSFMAQYEGYSRM
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagccgctggattacgaggagctgaacgagaacgtcaagaaggtgcagtac
gcggtgcgcggggaactctacctccgcgcctccgagctccagaaggagggcaagaagatc
atcttcaccaacgtcggcaacccgcacgccctcggccagaagccgctcaccttcccgcgc
caggtggtggccctctgccaggctccgttcctgctcgatgatcccaacgtcggcctcatg
ttcccggcggatgccatcgcgcgcgccaagcactacctctccctggcgaccggcggttta
ggcgcttacagtgattcccgtggtatccctggaattaggaaggaggttgctgacttcatc
cagaggcgtgatggatatccaagtgatccagagctcatttacttgacagatggtgccagc
aaaggtgtcatgcagatgctgaacaccattatcagaaacgagagagatgggattttggtc
cctgttcctcaatacccactttattctgctaccatttccctctttggtggctctctggtt
ccgtactacttggaagaagaggctaactggggccttgactttgtcaatatccgaaaaaca
gtggcagaggcaagatcaaagggaatcactgttcgagcaatggtgattataaatccggga
aatcccactggccaatgccttagtgaagcaaatataaaggaagttctgcaattttgctac
catgaaaacttagttctgcttgcagatgaagtgtatcagcagaatgtttatcaagatgag
cgcccgtttataagcgcaaaaaaggttttgtttgacatgggtccaccgctaagcagggag
gttcagcttgtttctttccacactgtgtccaaagggtactggggagagtgtgggcaacgt
ggtggatactttgaaatgacaaatcttcctccacagacagtagatgagatctacaaggtt
gcatcaatagcactgagcccgaatgtccctgggcaaatttttatgggagtgatggttaac
cctcctaaacctggagatatctcatacctgaagtttgctgctgaaagcaagtccatcctc
gattctttgaggaggagagcacgcatgatgacagatggtttcaacagttgccgaaatgtc
gtgtgtaatttcacagaaggagctatgtactcattcccccaaatacgcctgccaccaaga
gcaatcgaggcagcgaaaagagctggcaaagcaccagatgttttctactgcctcaagctt
ctggaagcaactgggatttccactgttccgggatctggttttggtcagaaggaaggggtg
ttccacctccggacgacgatccttcctgcagaggaagacttccctgccatcatgtcgagc
ttcaagaatttcaatgactcattcatggcgcaatacgagggctactccaggatgtga

DBGET integrated database retrieval system