KEGG   Setaria italica (foxtail millet): 101770285Help
Entry
101770285         CDS       T02818                                 

Definition
(RefSeq) ent-kaurene oxidase 2
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00904  Diterpenoid biosynthesis
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    101770285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sita00199]
    101770285
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     101770285
Cytochrome P450 [BR:sita00199]
 Cytochrome P450, plant type
  CYP701 family
   101770285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Ifi-6-16 DUF4616
Motif
Other DBs
NCBI-GeneID: 101770285
NCBI-ProteinID: XP_004966049
UniProt: A0A368QXE8
LinkDB All DBs
Position
IV
AA seq 500 aa AA seqDB search
METVLASIAAGGMVAAAALAAGASRVAGQKDRLNAPPAVPGLPIIGNLHQLKEKKPHQTF
ARWAQVYGPIYTIRSGASSMAIVNSTEVAKEAMVAKFQSISTRKLPAAISVLSRDKKMVA
TSDHGDFHKIAKRYIMLSVLGASGQKQFRGIRDMVIGNMLSTFHALVANDPKAPVNFREV
FKDELFRLSLIQALGEDVSSIYVEEFGKIISKEEIYQIAVVDPMMCALEVDWREFFPYLG
WIPNQSFDTTVSTTEARRTAVVRALINQQKKRIARGEARVSYLDFLLAQNTLTDEQVTSL
IWEAIIEAADTTLSTTEWAMYELSKNQEKQERLYEEIQEVCGNETVTEDDLPRLPYLNAV
FHETLRRHPSVSVVPPRFVHEDTNLAGYDIPAGTEVIVNLYGCNMNKNDWDEPEEWKPER
FLDGRFERADKFKTMAFGAGRRVCAGATQATNISCTAMARFVQDFAWRLKEGDEGKDGTI
QFTTNRLYPLHVYLTPRGRK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagactgtgttggcatctatcgccgccggcgggatggtcgcagcggccgcgctcgcc
gcgggggccagccgggtcgcggggcaaaaggaccgcctcaacgcacccccagctgttcct
ggtttacctatcattgggaaccttcatcagctgaaagaaaaaaagcctcatcaaaccttt
gcaagatgggcccaagtctacgggccaatatacactataagaagtggtgcatcttctatg
gctatcgtcaattcaactgaagttgccaaagaggctatggttgcaaagttccaatccata
tctactcggaaactacccgctgcaatttcagtgctcagtcgtgacaaaaagatggttgct
acaagtgaccatggcgacttccataaaatagcgaagcgctatattatgctgagcgtgctg
ggcgcttctggccagaaacaatttcggggcataagggacatggtgattggtaacatgttg
agcaccttccacgcattggtggctaatgaccccaaagctcctgtgaacttccgggaagtt
ttcaaggatgagctattccgcctatccttgattcaggctttaggtgaggatgtgagctcg
atctacgtagaagagtttgggaaaattatatcgaaggaggaaatctaccagatcgctgtg
gttgacccgatgatgtgtgctcttgaggtcgactggagggagttcttcccctacctcggt
tggattccaaatcagagctttgacacaacagtgagtacaacagaagctagacgaactgca
gtcgtacgagccttgatcaatcagcagaagaaaagaatcgcacgcggagaggctcgggta
tcctatctggacttcctgctagcacagaatacactgactgatgagcaagtgacgtcactg
atctgggaggcaatcatagaagctgcagatactactctgtccacaaccgaatgggccatg
tatgagctctccaagaaccaagaaaaacaggaacgtctttacgaggaaattcaagaggta
tgcggcaatgagacagtcactgaggatgacctcccacggttaccttacttgaacgcggtg
ttccatgagacccttaggcgtcatccttcagtttcagtagtgcctccacgatttgtccat
gaggataccaacttggctggctatgacattccagccggcacagaggtgatcgtcaacctc
tatggatgcaacatgaacaagaacgactgggacgagccggaggaatggaagcccgagagg
tttctggatgggaggttcgagcgtgcggacaagtttaagaccatggccttcggcgccgga
aggagggtctgtgctggcgccacgcaggctacgaacatctcgtgcacggccatggcgagg
ttcgtgcaggactttgcctggaggctcaaggaaggcgacgagggcaaggatggaaccatc
cagtttacgaccaacaggctttaccctttgcacgtgtacctcacaccgagaggaaggaaa
tga

DBGET integrated database retrieval system