KEGG   Setaria italica (foxtail millet): 101772737Help
Entry
101772737         CDS       T02818                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00020  Citrate cycle (TCA cycle)
sita00190  Oxidative phosphorylation
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
sita01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101772737
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101772737
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101772737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 101772737
NCBI-ProteinID: XP_004972473
UniProt: A0A368RGX5
LinkDB All DBs
Position
VI
AA seq 619 aa AA seqDB search
MWRSCVSRGLSRAKASASRLLSTASSSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNT
ACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAP
KAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQ
AMKHNTQFFVEYFALDLIMDNEGNCQGVIALNMEDGTLHRFRASNTILATGGYGRAYFSA
TSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERF
MERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISET
AAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDSVISGLLAAGEAACAS
VHGANRLGANSLLDIVVFGRACANRVADISKPGQKQKPLEKDAGEKTIAWLDKLRNANGS
LPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLISKAWESFHDVKLSDRSLIWNSDLIET
IELENLLINACITMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWENEKVRLAYRPV
HMNTLDEEVESFPPKARVY
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcagctgcgtctcgcggggcctctccagggccaaggcctccgcctccaggctc
ctctccacggcatcgtcgtcctacacggtggtggaccacacgtacgacgcggtggtggtg
ggtgccggcggcgcgggcctccgagcggcgatcggcctctccgaacacggcttcaacacg
gcgtgcatcaccaagctcttccccacgcgctcgcacactgtcgccgcacagggaggcata
aatgctgcgctcggaaacatgactgaagatgattggaggtggcatatgtatgatactgtt
aagggaagcgattggcttggtgaccaggattctattcaatatatgtgcagagaagcacca
aaagctgttatagagcttgagaactatgggttaccattttcaagaaccgaagagggaaag
atataccaacgtgcctttggaggacagagcttagattttggaaaaggtggacaggcctac
cgttgtgcctgtgctgctgacagaacagggcatgctatgctacacacactatatggtcaa
gcaatgaagcacaatactcagttttttgtggaatattttgcattagaccttatcatggac
aatgaaggcaactgtcagggagtcattgccttaaacatggaggatggcacccttcaccgt
ttccgtgcttctaatacaattctagccacaggaggttatggcagggcctatttctcagca
acctcagcacacacttgtactggagatggcaatgctatggtcgcacgtgctggtttacct
cttcaagatcttgagtttgtgcagttccatcctacgggcatttacggtgccggatgcctg
attactgaaggttcccgtggtgaaggtggtatccttagaaacagtgaaggtgaacggttc
atggaacgatatgctcctacggcaaaagatcttgcttctcgtgatgttgtttcaagatcg
atgacaatggaaattagagaaggccgtggtgttgggccattgaaggaccacatttatttg
catctgaaccatctgccgcctgaagttctgaaggaaaggcttcctggtatttctgaaact
gctgctatttttgctggtgttgatgtcaccaaggagccaattccagttttgcctactgtg
cactacaatatgggtggtatcccaacaaactaccatggggaggtagtggatatcaagggt
gataatccagattctgttatttctggtctattggctgctggtgaagcagcgtgtgcatct
gtccatggtgcaaaccggctaggcgcaaattcactccttgacatagttgttttcggcaga
gcttgtgcgaacagggttgctgatatttctaagccaggtcagaagcagaaacctcttgaa
aaagatgctggagaaaagaccatagcctggttggacaaactgaggaatgccaatgggtca
ttgccaacttccaagatccgtctcaacatgcagcgtgttatgcaaaacaatgctgctgta
ttccgtacacaagaaactcttgaagaaggttgtaagctgattagcaaagcatgggaaagt
tttcatgatgtgaagctcagtgatcggagtctcatttggaattccgacttgatagagacc
attgagctggaaaatctgttgataaatgcatgcataactatgcattcagcggaggctcga
aaggaaagcagaggagctcatgctcgtgaagatttcacgacaagagacgatgagaagtgg
atgaagcacacactggggtactgggagaatgagaaggtccgattggcttacaggccggtg
cacatgaacacattggacgaggaagtcgagtcattcccacccaaagcgcgtgtttattga

DBGET integrated database retrieval system