KEGG   Setaria italica (foxtail millet): 101778667Help
Entry
101778667         CDS       T02818                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita03030  DNA replication
sita03410  Base excision repair
sita03420  Nucleotide excision repair
sita03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sita00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101778667
   03410 Base excision repair
    101778667
   03420 Nucleotide excision repair
    101778667
   03430 Mismatch repair
    101778667
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sita03032]
    101778667
   03400 DNA repair and recombination proteins [BR:sita03400]
    101778667
Enzymes [BR:sita01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101778667
    6.5.1.6  DNA ligase (ATP or NAD+)
     101778667
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101778667
DNA replication proteins [BR:sita03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101778667
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101778667
DNA repair and recombination proteins [BR:sita03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101778667
   NER (nucleotide excision repair)
    Other NER factors
     101778667
   MMR (mismatch excision repair)
    Other MMR factors
     101778667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 TrmB
Motif
Other DBs
NCBI-GeneID: 101778667
NCBI-ProteinID: XP_012704422
LinkDB All DBs
Position
IX
AA seq 626 aa AA seqDB search
MAAAYWKPGEPVPFLFLARALDLISNESGRIVITEILSNVFRTVMVTTPDDLLATVYLSA
NRIAPPHEGIELGIGDASVIRALAEAYGRKEEHVKKDLKELGDLGLVAKASRSSQKMMFK
PKPLTISRVLSTFRTIAKESGKDSQDKKRNHIKGLLVAATDCEPQYITRLLQSKMRIGLA
EKTVQMALGQAAVYSDKKSSPPEVQSPFEEAAKIIKQVYSVLPIYDKIVPALLEAGVWKL
PETCKFSIGVPVGPMLAKATKSVSEIIDKFQGLEYTCEYKYDGERAQIHCMEDGSVEIYS
RNAERNTGKYPDVVDAVSRFRKPTVKSFVLDCEIVAYDREKKKILPFQILSTRARKGVTV
NDIKVSVCTFGFDILYMNGKPLLQEQLKIRREHLYNSFEEVPGVFQLATAITSNDLEEIQ
KFLDTAVNSSCEGLIIKTLDKDATYEPAKRSNNWLKLKKDYMDSIGDSLDLVPIAAFYGR
GKRTGVFGSFLLACYDEQNEEYQTICNIGTGFSEQQLEERSSSLRSKVIEKPKAYYRFAD
TMDPDVWFEPSEVWEVKAADLSISPVHRAANGIVDPNKGISLRFPRLLRLRDDKSPEQAT
TSEQVADMYRAQKINHGYNQEDEDDD
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcctattggaagcctggtgagcccgtgccattcctgtttctggctcgggca
cttgatctcatctccaacgagagtggccggattgtcattactgaaatcctatcaaatgtg
ttccggacagtgatggtgacgacaccggatgatctccttgcaacggtgtacctctcagcc
aatcggattgcgcctcctcatgaggggattgagctcggaattggggatgcatcagtcatc
cgtgcacttgcagaagcatacggacgcaaagaggagcatgttaagaaggaccttaaggaa
ttgggtgatttggggcttgtggcgaaagcaagcaggtcatcgcagaagatgatgtttaag
ccaaaaccactgacaatatctcgggtgcttagcacttttcggacaattgcaaaggagtca
ggcaaagacagccaagataaaaaaagaaaccatatcaagggacttcttgttgctgcgact
gactgtgaacctcaatacattacacgtcttcttcagtcaaaaatgaggatcggcctggca
gagaaaactgtccaaatggctcttgggcaagctgccgtatattctgacaaaaaatcttca
ccaccagaagttcaatcacctttcgaagaggctgcaaaaataattaaacaagtatattca
gttcttccaatctacgataaaattgtcccagcgctacttgaagctggagtttggaagctt
ccagagacatgcaaattttccataggtgtacctgttggtcctatgttagcaaaagcaaca
aaatctgtctcggagatcattgacaagtttcaggggcttgagtacacttgtgagtacaag
tatgatggtgaaagggctcagatacattgcatggaggatggttcggtagagatttatagt
cggaatgctgaaagaaacaccggaaagtatccagatgttgttgatgcagtttctagattc
cgaaagcctacagttaaatcatttgtcttggactgtgaaattgttgcctacgatcgtgaa
aaaaagaaaattttgccttttcagatacttagcacaagggcccgcaaaggtgttaccgta
aatgacatcaaagtttctgtctgtacttttggctttgatattctttacatgaatgggaaa
cctctcctccaggaacaactcaaaattcgtcgagagcatctttacaactctttcgaggaa
gtaccaggtgtttttcaattggcaactgcaattacatcaaatgacctggaggagatacag
aaatttcttgacacagctgtcaactccagttgtgaagggttgatcatcaagacattggat
aaagacgctacatatgagccagcgaagcgatcaaacaattggttgaaactgaagaaggac
tacatggatagtattggagactctttggacttggtaccgattgctgccttttatgggaga
ggaaaacggacaggtgtctttggatcattcctcctggcatgctatgatgagcagaatgaa
gaatatcaaacaatatgcaacataggtactggattttctgagcaacagctcgaagaacgt
tcttcaagccttcgaagtaaagtgatagaaaagcctaaggcatactacagatttgctgac
acaatggaccctgatgtatggtttgagccatcagaggtgtgggaggttaaagctgcagat
ctgagcataagtcctgtgcatcgtgctgctaacggtatagttgatccaaacaagggtatc
tccttaagatttcctcgtttgttgcgattacgtgatgataaaagcccagaacaggcgacc
acatctgagcaagtcgcggacatgtaccgggctcaaaagatcaaccacggttataaccag
gaggatgaggatgatgactga

DBGET integrated database retrieval system