KEGG   Setaria italica (foxtail millet): 101782952Help
Entry
101782952         CDS       T02818                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1 isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101782952
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sita03036]
    101782952
Enzymes [BR:sita01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101782952
Chromosome and associated proteins [BR:sita03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101782952
   Polycomb group proteins
    PRC2-EZH2 complex
     101782952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 101782952
NCBI-ProteinID: XP_004964751
UniProt: A0A368QRG3
LinkDB All DBs
Position
IV
AA seq 956 aa AA seqDB search
MRVGFRGRCCGDRSVRGNLGGDLTRLWGAEVRASDFEAELLAASFVCATVRVGSAGDVLV
SAAAVTSITAVGAEEENAASPYVLSVIDSLKKRITSDRLTYIKNRLGENKGNLSTFTQRT
YNLSKSKPINTLKGTDLASNLLTKRQDDALCTLHSADICPADKDGSSFQDESLFSSSNAI
LGGNLSAKNSIRPIKLPEVPKLPPYTTWIFLDRNQRMSEDQSVLGRRRIYYDASCGEALI
CSDSEEEGIDDEEEKKEFKHSEDCIIRMTVQECGMSDAVLHTLAQHLDRATDDIKARYEI
LQGEKTQDSCKKVIEHNAKVEDLYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVF
PTEKQPACSGIADGASCGKYCYKASEPDSVAGIDHMLIDGEEPSHSSGNAMNQPGTNRKK
NGSSGRKTKSQQSETSSTAMAVSESSDSEVHPISNKSPQPSPSPSKVKIGPKGGIRKITN
RRIAERILMSVKKGQREMASSDSNSVSGSPLARDMKLRSNTRNGNKESFVSSQQNSPSTR
STRKKSTPQIGNSSASAEAQNDSMEEDGYDSSRKEEFVDENICKQEDSFRSWKPIEQGLL
VKGLEIFGRNSCLIARNLLGGMKTCRDVFQYMNYIENSSASGTLSVVDSLVKGYIKGNEL
RTRSRFFRRRGKVRRLKYTWKSAGYHSIRKRITERKDQPCRQYNPCGCQSACGKQCPCLT
NATCCEKYCGCSKICKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTL
GVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVNKHEYLGEYTGELISHK
EADKRGKIYDRENSSFLFNLNNEFVLDAYRMGDKLKFANHSPDPNCYAKVIMVAGDHRVG
IFAKERILAGEELFYDYRYEPDRAPAWARKPEDSRGKDDGQPSNGRAKKLAQNTRG
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaggatttcgtggtcgatgctgcggcgatcgatcggttcgggggaatttgggt
ggagatctgacgcgcttgtggggagctgaggtgcgggcgtcggatttcgaggcggagctt
ttggctgccagcttcgtttgtgcgactgtgcgtgtgggctccgctggggacgttttggta
tctgcggcggcggttaccagtattacggctgtgggagctgaagaagaaaatgctgcctcc
ccctatgttttatctgtaattgattcattaaagaagaggattacgtcagaccgtttaact
tacatcaagaataggttaggggagaacaagggtaacctcagcacatttacacagaggact
tacaatttgtcaaaaagcaagccaattaatacattaaagggtactgatttagcatcaaat
ttgctcacaaaaaggcaagatgatgcgctatgcaccctgcatagtgctgatatttgtcct
gctgacaaagatggcagcagttttcaagatgaaagtcttttctcctcatcgaatgccatt
ttgggtggaaatctcagtgcaaagaattctattcgaccaattaaactaccagaagtgcca
aagcttccaccttatacaacatggatatttttggacaggaaccagaggatgtcggaagat
caatctgtacttggtcggcggaggatttactatgatgccagttgtggtgaagcactaatt
tgcagtgatagcgaagaggaaggcattgacgatgaggaggagaagaaggaatttaaacat
tcagaagattgtattattcggatgactgttcaagaatgtggcatgtcagatgctgtactg
catacgctggctcaacatcttgatagggctactgatgacataaaggccaggtatgagatc
ctgcaaggtgagaaaactcaggattcttgtaagaaagtgattgagcataatgccaaagtg
gaagatttgtacggtgacaaagacttggatgcagcattggattcctttgacaatctcttc
tgtcgacgatgtctagttttcgattgcaagctacacgggtgttctcaagatttagtgttt
cctacagaaaaacagccagcttgtagtggcattgctgatggtgcatcctgtggtaaatat
tgctataaggcctctgaaccggattctgtagctggaattgatcacatgcttattgatggt
gaggagccatctcactcatcaggcaatgcaatgaaccagccaggcacaaataggaaaaag
aacggctccagtggaaggaagactaaatctcagcaaagtgaaacctcttcaactgcaatg
gctgtctcagaaagcagtgactcagaagtacatccaataagcaataaatctccgcagccc
tcccctagtccctccaaagttaaaattggtccaaaaggcggaatcagaaagataacaaat
agaagaatcgccgagagaattcttatgagtgtgaaaaaaggacaaagggaaatggcatca
tcagattctaattctgttagtggctcccctttggcaagggacatgaagcttaggtctaat
acacggaacggaaataaggaatcatttgtatcttctcaacagaattctccaagtacaaga
agtaccagaaagaagagtacacctcaaattgggaatagctcagcttctgctgaagctcag
aatgattcaatggaggaagatggttatgatagttcaaggaaagaagaattcgttgatgag
aatatatgcaagcaagaggatagctttagatcctggaagccaatcgagcagggacttctg
gtgaaaggattagagatttttgggaggaacagttgtttaattgctcggaaccttcttggt
ggaatgaagacatgcagagatgtttttcagtatatgaattatattgaaaacagcagcgcg
tctggaactcttagtgttgttgattctcttgttaaaggatatataaagggtaacgagttg
cgcacgaggtcaaggtttttcagaaggcgaggtaaagtccgtcgcttgaagtacacctgg
aaatctgcaggttaccattctataaggaaaaggattacagaaaggaaggatcagccctgt
cgacaatataatccttgcggttgtcaatctgcatgtgggaagcagtgtccatgtctcaca
aatgcgacatgctgtgagaaatattgcgggtgttccaaaatttgcaagaaccgttttcga
ggttgtcattgtgcaaagagtcagtgtcgcagccgccaatgtccgtgttttgctgctgac
agggaatgtgatcctgatgtttgcagaaactgctgggttgggtgtggtgacggtacgttg
ggagttccaaaccagaggggagataattatgaatgtcggaacatgaaactgcttcttaaa
caacaacaacgggtcttacttggaagatccgatgtttctggctggggagcattcctgaag
aatagtgtcaacaaacatgaatatcttggcgagtacactggggaactaatctcccacaag
gaagcagataagcgtggaaagatctacgatcgtgagaattcatcgttccttttcaatctg
aacaatgagtttgttcttgatgcgtacagaatgggtgacaagctgaaatttgccaaccat
tcccctgacccgaattgctatgccaaggttataatggtagctggcgatcatagagtgggc
atatttgccaaagaaagaatcctcgccggtgaagagttgttctacgattaccgctacgag
cctgatagagcccctgcttgggcccgaaagcctgaggattcccgaggaaaggatgacggg
caaccatccaatgggcgcgcaaagaagctcgcccaaaacaccagaggctga

DBGET integrated database retrieval system