KEGG   Setaria italica (foxtail millet): 101783048Help
Entry
101783048         CDS       T02818                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sita00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101783048
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101783048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101783048
NCBI-ProteinID: XP_004958608
UniProt: K3ZXQ6
LinkDB All DBs
Position
II
AA seq 151 aa AA seqDB search
MVKAVAVLAGSDVKGTIFFSQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTGP
HFNPAGKEHGAPEDENRHAGDLGNVTAGEDGVANVNITDCQIPLTGPHSIIGRAVVVHAD
PDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtcgctgtcctcgctggcagtgatgtcaagggcaccatcttcttttcc
caagagggagatggtccaaccactgtgaccggaagtatctctgggctcaagccagggctc
catgggttccatgtgcacgcgcttggtgacaccaccaatggctgcatgtcgactggtcca
cacttcaatcctgctggtaaggagcatggtgcaccggaagatgagaaccgccatgccggt
gatcttgggaatgtgacagctggagaagatggtgttgctaatgtcaatattactgactgc
cagattcccctcactgggccacactcaatcattggccgagctgtagttgtccatgctgat
cctgatgaccttggcaagggtggacatgagcttagcaagagcactggaaatgctggtggc
cgtgttgcttgtggtatcattgggctccagggttag

DBGET integrated database retrieval system