KEGG   Setaria italica (foxtail millet): 101784782Help
Entry
101784782         CDS       T02818                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00564  Glycerophospholipid metabolism
sita01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101784782
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     101784782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA FAD_binding_3 Pyr_redox_2 NAD_binding_8 Pyr_redox HI0933_like Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-GeneID: 101784782
NCBI-ProteinID: XP_004975130
LinkDB All DBs
Position
VII
AA seq 630 aa AA seqDB search
MAAWRLRRSGAVALAASSAVAVALAASSASASDPSTAALDAARQRVAKPGAAPPPRDAQR
AALAGSTAAEPLDVLVVGGGATGCGAALDAATRGLRVGLVEREDFSSGTSSRSTKLIHGG
VRYLEKAVFNLDYGQLKLVFHALKERKQVIDNAPHLCHALPCMTPCFNWFEVVYYWFGLK
FYDLVAGRRLLHLSRYYSVDESVELFPTLAKSGHDRSLRGTVVYYDGQMNDSRLNVGLAC
TAAVVGAAVLNYAEVVSLIKDESGERIIGARIRDTLSGKEFETFAKVVINAAGPFCDSVR
KMANSNIVPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSS
TAITMLPEPHEDEIQFILDAISDYLNVQVRRSDVLSAWSGIRPLAMDPSAKNTESISRDH
VVFEDYPGLITITGGKWTTYRSMAEDAVNAAVRSGNLKPANGCVTDNLHIVGGYGWDPAS
FTVLAQNYKRMKKTYGGKVIPGAMDSAVSKHLSHAYGTLAEQVATIAQNEGLGKRLAHGY
PFLEAEVAYCARHEYCESAVDFVARRCRLAFLDTDAAGRALPRIIEILASEHKWDKARKK
VELQKGREFLETFKSSKNAQFSDGKHNGKA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtggcgcctccgccgctcgggtgccgtcgccctcgccgcctcctccgccgtc
gccgtggccctcgccgcctcatccgcgtccgcctccgacccctccaccgcggccctcgac
gccgcgcggcagcgcgtggcgaagccgggggccgcgccgcctcctcgcgacgcgcagcgc
gcggcactggccgggtccacggccgcggagcccctcgacgtgctcgtggtcggcggcgga
gccactggatgcggggcagcgctcgatgccgccacccgtgggctccgggtgggcctcgtg
gagcgcgaggacttctcctccgggacctcctcccgatccaccaaactcatccacggcggc
gtacgctacttggagaaggcagtgttcaatcttgattatgggcagctcaaacttgttttt
cacgcacttaaggaacgcaagcaggttattgataatgctccccatctgtgccatgctttg
ccatgcatgactccttgctttaactggtttgaggttgtatactactggtttggtttgaag
ttttatgatctagttgctggaagaaggctactacatttgtcacgatattattctgtagat
gaatccgtcgaacttttcccaaccctagcaaaaagtggccatgatcgtagcctaagagga
acagtggtatactatgatggtcaaatgaatgattctcggctgaatgtggggttggcatgc
actgctgcagttgttggtgcagctgttctcaattatgctgaagtggtctccctcattaag
gatgaatctggagagagaatcattggggcacgcattcgtgacacactatcaggtaaggag
tttgaaacctttgcaaaggtggtaattaatgcagcaggaccattctgtgactctgtgagg
aagatggctaacagtaatatagtgcccatgatctgtccaagtagtggtgtgcacattgta
cttcctgattactattcccctgaagggatggggctaattgtccctaaaaccaaggatggt
agagttgtatttatgttgccatggttgggaaggactgttgcgggaacaactgattctagc
acagcaataacaatgcttcctgaaccacatgaggatgaaatacagttcatattggatgca
atctctgactatcttaatgttcaggtaaggcgttcggatgttctttctgcctggagtggt
atacgtcctttggccatggatccatcagcaaagaacactgaaagtatttctcgagatcat
gttgtatttgaggactacccagggctaataacgataactggtggaaaatggacgacctat
agaagcatggctgaagatgctgtaaatgcagcagtaaggtctgggaatttgaagccagct
aatggttgtgtgaccgataacttgcatatcgttggtggatatggatgggatcctgcttct
tttactgtccttgcccagaattataagcgaatgaaaaagacatatggtggcaaagttatt
ccaggtgcaatggacagtgctgtatcgaaacatttatcacatgcatatggaactttggct
gaacaagtggctactattgcccagaacgaaggcttgggaaagcggcttgctcatggatac
ccatttttggaagctgaagtagcatactgtgctcgtcatgagtattgtgaatctgctgtg
gactttgttgcaaggagatgccggctagctttccttgacacagatgcagctggcagagct
ttgccccggatcattgagattttagcttccgagcacaagtgggacaaggcaaggaagaag
gttgaattgcagaagggtagagagtttctggaaacatttaaatcatccaagaacgctcaa
ttcagtgatgggaagcataatggtaaggcatga

DBGET integrated database retrieval system