KEGG   Setaria italica (foxtail millet): 19526795Help
Entry
19526795          CDS       T02818                                 

Gene name
rbcL, W841_p054
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00630  Glyoxylate and dicarboxylate metabolism
sita00710  Carbon fixation in photosynthetic organisms
sita01100  Metabolic pathways
sita01200  Carbon metabolism
Module
sita_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sita_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
sita_M00532  Photorespiration
sita_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    19526795 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    19526795 (rbcL)
Enzymes [BR:sita01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     19526795 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 19526795
NCBI-ProteinID: YP_008815759
UniProt: U5TUR4
LinkDB All DBs
Position
PT
AA seq 468 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYIAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTAYAKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKAQAETGEIKGHYL
NATAGTCEEMIKRAAFARELGVPIVMHDYLTGGFTANTSLSYYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREITLGFVDLLRDDFIEKDRSR
GIFFTQDWASMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGNEIIKAACKWSPELAAACEVWKEIKFE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaagtgttggatttaaagctggtgttaaggattat
aaattgacttactacaccccggagtacgaaaccaaggatactgatatcttggcagcattc
cgagtaactcctcagcccggggttccgcctgaagaagcaggggctgcagtagctgcggaa
tcttctactggtacatggacaactgtttggactgatggacttaccagtcttgatcgttac
aaaggacgatgctatcacatcgagcccgttcctggggaggcagatcaatatatctgttat
atagcttatccattagacctatttgaagagggttctgttactaacatgtttacttccatt
gtgggtaacgtgtttggtttcaaagccctacgcgctctacgtttggaggatctacgaatt
cccactgcttatgcaaaaactttccaaggtccgcctcacggtatccaagttgaaagggat
aagttgaacaagtatggtcgtcctttattgggatgtactattaaaccaaaattgggatta
tccgcaaaaaattacggtagagcgtgttatgagtgtctacgcggtggacttgattttacc
aaagatgatgaaaacgtaaactcacaaccatttatgcgctggagagaccgttttgtcttt
tgtgctgaagcaatttataaagcacaagcagaaactggtgaaattaaggggcattacttg
aatgcgactgcaggtacatgcgaagaaatgattaagagagctgcatttgcaagggaatta
ggggttcctattgtaatgcatgactacttaactggaggattcaccgcaaatactagtttg
tcttattattgccgcgacaacggcctacttcttcacattcaccgagcaatgcatgcagtt
attgatagacagaaaaatcatggtatgcatttccgtgtattagctaaagcattgcgtatg
tcggggggagatcatatccactccggtacagtagtaggtaagttagaaggggaacgcgaa
ataactttaggttttgttgatttattgcgcgatgattttattgaaaaagatcgttctcgc
ggtatctttttcactcaggactgggcatccatgccaggtgttataccggtggcttcaggg
ggtattcatgtttggcatatgccagctctgaccgaaatctttggagacgattctgtatta
caatttggtggaggaactttaggacatccttggggaaatgcacctggtgcagcagctaat
cgtgtggctttagaagcctgtgtacaagcccgtaacgaagggcgcgatcttgctcgtgaa
ggtaatgaaattatcaaagcagcttgcaaatggagtcctgaactagccgcagcttgtgaa
gtatggaaggagatcaaatttgaatag

DBGET integrated database retrieval system