KEGG   Streptococcus intermedius C270: SII_0261Help
Entry
SII_0261          CDS       T02831                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
siu  Streptococcus intermedius C270
Pathway
siu00010  Glycolysis / Gluconeogenesis
siu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:siu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SII_0261
   00500 Starch and sucrose metabolism
    SII_0261
Enzymes [BR:siu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SII_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AGU77466
LinkDB All DBs
Position
265084..266523
Genome map
AA seq 479 aa AA seqDB search
MGKFPADFLWGGATAANQYEGAYDVDGKGLSVQDVTPKGGLSSNAGDLNPLITDRPTADN
LKLEGIDFYHRYKEDIALFAEMGFKVYRTSIAWSRIFPNGDETEPNEAGLKFYDDLFDEL
AKYNIEPLVTLSHYETPLHLARQYNGWANRDLIGFYERYVRTVFIRYKDKVNYWLTFNEI
NSVLHAPFMSGGIATPVEELSKQDLYQAVHHELVASALATKIGHEINPDFKIGCMVLAMP
TYPMTPKPEDVLAAREFENQNYLFSDIHVRGKYPAYMNRFFKENDIEIQFAPGDKELMAE
HTVDFISFSYYMSVVAAHDPENYSSGKGNVLGGLQNPYLTASEWGWQIDPIGLRLVLNAF
YDRYQLPLFIVENGLGAKDVLIDGPNGPTVEDDYRIDYLQQHLQQVGEAIEDGVELWGYT
TWGCIDLVSASTAQMSKRYGFIYVDRNDDGTGTLARYKKKSFEWYKEVIATNGEKLYED
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatttccagcagattttctttggggtggtgcaacagctgccaatcaatacgaa
ggtgcttacgatgtggacggtaaaggtctttcggttcaagatgtgacgccaaaaggcggt
ctatcgtctaacgcgggtgatctcaatcctttaattacagataggccaacagctgacaac
ctcaaattggaaggaattgacttttatcatcgttacaaagaagacattgccctttttgca
gaaatgggcttcaaggtttatcgtacttctattgcttggtcacgaatttttccaaatggc
gatgaaacggagccaaatgaagcagggctaaagttttatgacgacctttttgatgaattg
gccaaatataacattgaacctttagtgactttatcgcattatgaaacacctttgcatttg
gcgcgtcaatataatggttgggcaaatcgtgatttgattggcttttatgagcgttatgtt
cgtactgtctttattcgttacaaagataaggtgaactattggttgacctttaatgaaatc
aactctgttttacatgcgccgtttatgagtggagggattgcaactccagtagaagaattg
tccaaacaagatctttatcaagctgttcatcacgaactagtggcatcagctcttgcaact
aaaattgggcatgaaatcaatccagattttaagattgggtgtatggtgctagccatgccg
acttatccgatgacgccaaaaccagaggatgtactggctgcccgtgagtttgaaaatcaa
aattatctcttttcagatattcatgtgcgtggtaaatatccagcttatatgaaccgcttc
ttcaaagaaaatgacattgagatccaatttgcaccaggtgataaagaattgatggcagag
cataccgtggatttcatctccttctcttattacatgagcgtagttgctgcgcatgaccca
gaaaattattcttctgggaaaggaaacgttctaggaggtctacaaaatccttatttaaca
gcttcagaatggggctggcaaattgatccaattggtctgcgtttggttctcaatgctttc
tatgaccgttaccaattaccactctttatcgtagaaaatggtcttggtgctaaggatgtt
ttgatagatggtcctaatggtccaactgttgaagatgattatcgcattgattatctgcaa
caacatttacaacaggttggtgaagccattgaggatggcgttgaactctggggttacacc
acttggggctgtattgaccttgtgtctgcttcaacagctcagatgagtaaacgctacgga
tttatctatgttgatcgaaatgatgatgggacaggaactttagctcgctacaagaagaaa
tcatttgagtggtataaagaagttattgcaacgaatggagaaaaactctatgaagattga

DBGET integrated database retrieval system