KEGG   Streptococcus intermedius C270: SII_1047Help
Entry
SII_1047          CDS       T02831                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
siu  Streptococcus intermedius C270
Brite
Translation factors [BR:siu03012]
 Eukaryotic Type
  Elongation factors
   SII_1047 (tuf)
 Prokaryotic Type
   SII_1047 (tuf)
Mitochondrial biogenesis [BR:siu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SII_1047 (tuf)
Exosome [BR:siu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SII_1047 (tuf)
  Exosomal proteins of breast cancer cells
   SII_1047 (tuf)
  Exosomal proteins of colorectal cancer cells
   SII_1047 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AGU78222
LinkDB All DBs
Position
complement(1078679..1079875)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYSSIDAAPEER
ERGITINTAHVEYETAKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKYLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDIPVIQGSALK
ALEGDEKYEDIIMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
KVNDEVEIVGIREEIQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGIQRDEIERGQVLAKP
GSIHPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtaccatcggacac
gttgaccatggtaaaactaccctaactgcagctatcacgactgtacttgcacgtcgtctt
ccaagttcagttaaccaaccaaaagattattcatctattgatgctgctccagaagaacgc
gaacgcggaatcactatcaacactgcacacgttgagtatgaaactgctaaacgccactat
gctcacattgacgctccaggacacgcggactacgttaaaaacatgatcactggtgccgct
caaatggatggagctatccttgtagtagcttcaactgacggaccaatgcctcaaactcgt
gaacatatccttctttcacgtcaagtaggtgttaaatatcttattgtcttcatgaacaaa
gttgacttagttgacgatgaagaattgcttgaattggttgaaatggaaatccgtgatctt
ctttcagaatacgatttcccaggtgatgatattccagtaatccaaggttcagcacttaaa
gctcttgaaggtgatgaaaaatatgaagacatcatcatggaattgatgaatactgttgat
gaatatattccagaaccagaacgtgatactgacaagccattgcttcttccagtcgaagat
gtattctcaatcactggacgtggtactgttgcttcaggacgtatcgaccgtggtactgtt
aaagtcaacgacgaagttgaaatcgttggtatccgcgaggaaatccaaaaagcagttgtt
actggtgttgaaatgttccgtaaacaattggacgaaggccttgctggagataacgtaggg
gttcttcttcgtggtatccaacgtgacgaaattgaacgtggacaagttcttgctaaacca
ggttcaattcatccacacactaaattcaaaggtgaagtttacatccttactaaagaagaa
ggtggacgtcatactccattcttcaacaactaccgtcctcaattctacttccgtactaca
gacgttacaggttcaatcgaacttcctgcaggtactgaaatggtaatgcctggtgataac
gtaacaattgatgttgagttgatccacccaattgccgtagaacaaggaactacattctct
atccgtgaaggtggacgtactgtaggttcaggtatggttacagaaatcgaagcttaa

DBGET integrated database retrieval system