KEGG   Streptococcus intermedius C270: SII_1327Help
Entry
SII_1327          CDS       T02831                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
siu  Streptococcus intermedius C270
Brite
KEGG Orthology (KO) [BR:siu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SII_1327 (ahpF)
Enzymes [BR:siu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SII_1327 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_3 Thi4 DAO Glutaredoxin FMO-like Ribosomal_L21p NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGU78501
LinkDB All DBs
Position
complement(1388710..1390242)
Genome map
AA seq 510 aa AA seqDB search
MTLDETIKAQLKQYLGLLESDVVFQASLGQDEHSAKVQAFLEEIVAMSPRLSLENIAASR
QPSFTIAQAGQTGRVQFAGLPLGHEFTSFVLALLQVSGRAPKVKDAVIDRIRAIKQTLHF
ETYVSLTCHNCPDVVQALNMMAILNPTISHTMIEGGMFREEVENKKVMAVPTVFLNGDEF
ANGRMTIEQLLDKLSGPASSEEFDKKEPFDVLVVGGGPAGSSAAIYAARKGIRTGMVVET
FGGQVMETVGIENMIGTPYTEGPKLMAQVEEHTKKYPIDIMKNQRVQNIEKKDLIEVELE
NGAILKTKTAILSVGARWRNVNVPGEEEFRTKGVTNCPHCDGPIFTGKKVAVIGGGNSGI
EAAIDLAGLAEHVYVFEFLPTLKADQVLQDRVHQLKNVTVLTNVATKEIHGSDQVEAITY
LNRENNEEHKIELSGVFVQIGLLPNTDWLQNSSVALNERGEIIVDKQGATNVPGIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgactttagatgaaacaattaaagcacaacttaagcagtatttgggtcttctagaatct
gatgttgtgtttcaagcttctttaggtcaagatgaacattctgcaaaagtgcaagcattt
ttagaagaaatcgttgcgatgtctcctcgtttatcgttggaaaatatagcagctagccgt
cagccaagttttactattgctcaagcaggacaaacgggacgtgttcagtttgcaggtctt
cctttgggacatgaattcacatcttttgtgcttgctttgctgcaagtttctggtcgtgca
ccaaaagtaaaagatgctgttatagatcgaattcgagcgattaaacagacacttcatttt
gaaacttatgtcagcttaacctgtcataattgtccagatgttgtacaagctcttaatatg
atggctattctgaatccaaccattagtcacacaatgattgaaggaggtatgtttagagaa
gaagttgaaaataaaaaagtcatggctgttccaacagtttttctcaatggagacgaattt
gcaaatggtcgaatgactattgaacaactgcttgataaactttctggccctgcttcaagt
gaagaatttgataaaaaagaaccatttgatgtgttggttgttgggggtggccctgctggg
agcagtgcagccatttatgctgctcgtaagggaattcgtacaggtatggtcgttgaaacc
tttggcggccaggtaatggagaccgttggtattgaaaatatgattggtactccctataca
gaaggacctaaactgatggcgcaagtagaagaacataccaagaaatatccgattgatatc
atgaagaatcaacgtgtgcaaaacattgagaaaaaggatttgattgaagtggagcttgaa
aatggagccattctgaaaacaaaaacggctattctctctgttggagctcgttggcgaaat
gtcaatgttcctggtgaagaagaattccgaaccaaaggtgtcaccaattgtcctcattgt
gatggtcctatttttactggtaaaaaagtagctgttatcggcggaggcaattctgggatt
gaagcagcgattgacttagcgggtcttgcagaacatgtttatgtgttcgaatttctacca
accttgaaagctgatcaagtcttacaagatcgagtgcaccaacttaaaaacgtgactgtt
ttaaccaatgtagcaacaaaagaaattcatggttccgatcaagtcgaagctattacttat
cttaaccgtgagaataatgaagagcataaaattgagcttagtggtgtctttgttcaaatt
ggcctcttgcctaatacagactggttgcagaacagttcagttgctctaaatgagcgcggt
gaaatcattgttgataaacagggtgcgacaaatgttcctggaatttttgcagcaggtgat
tgtacagatagtgcctataaacaaatcattatttcaatggggtcaggagcaacagcagct
ctcggagcatttgattatttgattcgtcaataa

DBGET integrated database retrieval system