KEGG   Streptococcus intermedius C270: SII_1462Help
Entry
SII_1462          CDS       T02831                                 

Gene name
aspC
Definition
(GenBank) putative aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
siu  Streptococcus intermedius C270
Pathway
siu00220  Arginine biosynthesis
siu00250  Alanine, aspartate and glutamate metabolism
siu00290  Valine, leucine and isoleucine biosynthesis
siu01100  Metabolic pathways
siu01110  Biosynthesis of secondary metabolites
siu01130  Biosynthesis of antibiotics
siu01210  2-Oxocarboxylic acid metabolism
siu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:siu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SII_1462 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    SII_1462 (aspC)
   00220 Arginine biosynthesis
    SII_1462 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:siu01007]
    SII_1462 (aspC)
Enzymes [BR:siu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SII_1462 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     SII_1462 (aspC)
Amino acid related enzymes [BR:siu01007]
 Aminotransferase (transaminase)
  Class I
   SII_1462 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGU78628
LinkDB All DBs
Position
complement(1523240..1524454)
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSTKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKNIPNVDIDDVYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEAADWYPDIDDIRSKITSNTKAIVVINPNNP
TGALYPKEVLEELVDVARQNNLIIFADEIYDRLVMDGEKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKYHVKDYIEGLNMLSNMRLCSNVLSQHVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINEIPGLSATKPKAGLYIFPKIDREMYQVDDDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataaatcgacaaagttagaacatgtagcttatgatatccgaggtcct
gtcttagaagaagccatgcggatgcgtgcaaatggtgagaaaatccttcggttgaacaca
ggaaaccctgctgagtttggttttacggcaccagatgaagtgattcatgatttgattatg
aatgcacgggatagtgagggctattcagactcgaaagggattttttctgctcggaaagct
attatgcaatattgccagttaaagaatattccaaatgttgatattgacgatgtctacctt
ggaaatggagtcagcgagctgattgtcatgtctatgcaaggtttgctagacaatggtgat
gaggtgctggtacctatgccggattatcctctctggactgctgctgtgagtttagcagga
gggaatgctgttcactatctttgtgatgaagctgctgattggtacccagatattgatgac
attagatcgaaaattacttctaatacaaaagctattgtcgttatcaacccaaacaatccg
acaggagctctatatcctaaggaagttttagaagagctggttgacgttgcacggcaaaat
aatttgattatttttgcagatgagatttatgaccgtttagtgatggacggtgagaaacat
acggctatcgcaagtttggctcctgaccttttttgtgtcagcatgaacggcttgtctaaa
tcacatcgtattgctggttttcgtgtcggatggatggtactgtctggtcctaaatatcac
gtaaaagattatattgaaggcctgaatatgctatccaatatgcgtttgtgctcaaatgtc
ttatctcagcatgtggtacaaacatcgcttggaggctaccaatcagtcgatgaattgttg
cttcctggtggtcgcatttatgagcaacggaattttatttacaaggctatcaatgaaatt
ccgggtttgtcggcaaccaaacctaaagcggggctttatatttttccaaaaattgataga
gaaatgtatcaagtggatgatgacgaacaattcgtgttggatttcttaaagcaagaaaag
attttactggtgcatggacgaggctttaattggaaagatcctgatcatttccggattgtt
tacctgcctcgtgtagatgagttagcacaaattcaagagaagatgactcgtttcttaaaa
caatatcgacgatga

DBGET integrated database retrieval system