KEGG   Solibacillus silvestris StLB046: SSIL_0338Help
Entry
SSIL_0338         CDS       T02162                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
siv  Solibacillus silvestris StLB046
Brite
KEGG Orthology (KO) [BR:siv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SSIL_0338 (ahpF)
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SSIL_0338 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 Thi4 DAO NAD_binding_8 NAD_binding_7 Glutaredoxin FMO-like AlaDh_PNT_C K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: BAK14761
UniProt: F2F5H8
LinkDB All DBs
Position
372128..373684
Genome map
AA seq 518 aa AA seqDB search
MLDNQIKAQLQQYLSMLEGDLLIKVSVNDDKTSQEMLNLVEELEKMSPRITVQHALLERT
PSFSINKVGEGESGITFAGLPLGHEFTSLVLALLQVSGRAPKIDAAVVKRIQAIKQPLKF
ETYVSLTCHNCPDVVQALNIMAVLNPNISNTMVEGGAFQSEIKERDIMAVPTVYLNGENF
GGGRMELEDILTKLGEVSDGSEFADKEAFDVLVVGGGPAGSAAAIYSARKGIRTGIVADR
FGGQVNDTLSIENIIGTKATEGPAFVSSLEAHVLDYDIDVMKSQRAAKIEKKDFIEVTLE
NGAVLKGKTVILSTGARYRQLEVPGEEEFKNKGVAYCPHCDGPIFKGKDVAVIGGGNSGV
EAAIDLAGIVNHVTLIQRNSELKADKVLQERVYSLKNVTVITNALTTEITGTDKVNGLMY
KDVATGEEKHIELQGVFIQIGLLPNTEFLKGTVNMNAHGEIIVDNHGATNIPGVFAAGDC
TDTVYKQIVISMGSGATAALGAFDYMIRNVDSRDFVKA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgttagataatcaaattaaagcgcaattacaacagtatttatcaatgctggaaggtgat
ttattaattaaagtgagtgttaatgacgacaagacatcgcaagaaatgctcaatttagtt
gaagagttggaaaagatgtctcctcgtattacggtgcaacatgctttattagaacgtaca
ccaagtttcagtattaataaagtaggcgaaggagaatctggtataacatttgccgggtta
ccacttggtcatgaatttacatcattagttttagcgcttttacaagtttcaggacgtgca
ccaaaaattgatgcagcagttgtaaagcgtattcaggcgatcaaacagccgttgaagttt
gaaacgtatgtaagtttaacttgtcacaactgcccggatgtagtgcaggctttaaacatt
atggcggttttaaatccgaatatctcgaacacgatggtcgaaggtggagcattccaatct
gaaattaaagagcgagatattatggcggtgcctactgtatatttaaacggcgaaaacttc
ggtggtggtcgtatggagctggaagatattttaacaaagttaggtgaagtatcagacggc
tcggaatttgcggataaagaagcttttgatgtattagtagtaggtggcggtcctgccggt
tctgcagccgctatttattcggcgcgtaaagggattcgtacaggtattgtagccgatcgc
ttcggtggtcaagttaacgatacgttatcgatcgaaaatattattggaacaaaggcaaca
gaaggtccggcatttgtatcaagcttagaagcgcatgtattagactatgatatcgatgtg
atgaaatcccaacgtgctgcaaagatcgagaaaaaagattttattgaagtaacgttagaa
aatggcgcggtattaaaagggaaaacagttatcctttctacgggtgctcgttatcgtcaa
ctagaggtgcctggtgaggaagaatttaaaaataaaggtgttgcgtattgtccgcattgt
gacggtccgatttttaaagggaaagatgtagcggtaatcggtggcggtaactctggtgta
gaagcggctatcgacctagcaggtattgtaaatcatgttacgctaatacagcgtaacagt
gagttgaaggcggataaagtgttacaagagcgcgtttacagtttaaaaaacgttacagtc
attacgaatgctttaactactgaaattacaggaacggataaagtgaatggtttaatgtat
aaagacgttgctactggtgaagaaaagcatattgaattacaaggtgtattcattcaaatt
ggtttattgccaaatacagagttccttaaagggacggtaaacatgaatgcgcatggtgaa
attattgtagataaccacggggctacaaatattccgggagtctttgctgcaggtgattgc
acggatacggtgtataaacaaattgtcatttcaatgggttctggcgcaacagcagcttta
ggggcatttgactatatgattcgaaatgttgattcacgtgattttgtaaaagcataa

DBGET integrated database retrieval system